Crystal Structure of RBBP4 bound to PHF6 peptide. Determined by X-ray diffraction at 1.85 Å resolution. Released 14 Jan 2015.
Explore 4R7A in 3D Show helices and sheets RCSB PDB PDBe
4R7A contains 5 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-31 | 16 | |
| β-strand | 32-39 | 8 | 1 |
| β-strand | 47-54 | 8 | 2 |
| β-strand | 61-69 | 9 | 2 |
| β-strand | 77-87 | 11 | 2 |
| β-strand | 115-123 | 9 | 2 |
| β-strand | 129-133 | 5 | 3 |
| β-strand | 136-143 | 8 | 3 |
| β-strand | 149-153 | 5 | 3 |
| α-helix | 154-156 | 3 | |
| α-helix | 161-162 | 2 | |
| β-strand | 171-174 | 4 | 3 |
| β-strand | 183-185 | 3 | 4 |
| β-strand | 192-196 | 5 | 4 |
| β-strand | 202-206 | 5 | 4 |
| β-strand | 216-218 | 3 | 3 |
| β-strand | 221-223 | 3 | 4 |
| β-strand | 230-235 | 6 | 5 |
| β-strand | 242-247 | 6 | 5 |
| β-strand | 251-256 | 6 | 5 |
| β-strand | 267-270 | 4 | 5 |
| β-strand | 276-281 | 6 | 6 |
| β-strand | 288-293 | 6 | 6 |
| β-strand | 297-302 | 6 | 6 |
| β-strand | 311-314 | 4 | 6 |
| β-strand | 320-325 | 6 | 7 |
| β-strand | 332-337 | 6 | 7 |
| β-strand | 342-346 | 5 | 7 |
| α-helix | 347-349 | 3 | |
| β-strand | 366-370 | 5 | 7 |
| β-strand | 377-382 | 6 | 1 |
| β-strand | 389-394 | 6 | 1 |
| β-strand | 398-404 | 7 | 1 |
| α-helix | 406-409 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| PHD finger protein 6 | A | protein | 15 | Homo sapiens | Q8IWS0 (AlphaFold model) |
| Histone-binding protein RBBP4 | B | protein | 425 | Homo sapiens | Q09028 (AlphaFold model) |
>4R7A_1 PHD finger protein 6 (chains A) KSKKKSRKGRPRKTN
>4R7A_2 Histone-binding protein RBBP4 (chains B) MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKD FSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK INHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEG YGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHE SLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVAL WDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAE DGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP EGQGS
Structural Basis of Plant Homeodomain Finger 6 (PHF6) Recognition by the Retinoblastoma Binding Protein 4 (RBBP4) Component of the Nucleosome Remodeling and Deacetylase (NuRD) Complex. Liu, Z., Li, F., Zhang, B. et al. J Biol Chem (2015) 290:6630-6638. DOI 10.1074/jbc.M114.610196 · PubMed
Other PDB entries of the same protein (UniProt Q8IWS0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4R7A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.