Crystal structure of N-lobe of human ARRDC3(1-165). Determined by X-ray diffraction at 1.73 Å resolution. Released 1 Oct 2014.
Explore 4R7V in 3D Show helices and sheets RCSB PDB PDBe
4R7V contains 5 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-13 | 9 | 1 |
| α-helix | 20-22 | 3 | |
| β-strand | 23-24 | 2 | 2 |
| α-helix | 28 | 1 | |
| β-strand | 29-39 | 11 | 1 |
| β-strand | 42-44 | 3 | 3 |
| β-strand | 46-61 | 16 | 4 |
| β-strand | 73-90 | 18 | 4 |
| β-strand | 103-105 | 3 | 3 |
| α-helix | 106 | 1 | |
| β-strand | 108-117 | 10 | 1 |
| α-helix | 124-126 | 3 | |
| β-strand | 127-128 | 2 | 4 |
| β-strand | 132-143 | 12 | 4 |
| α-helix | 148-149 | 2 | |
| β-strand | 150-155 | 6 | 4 |
| β-strand | 157-158 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Arrestin domain-containing protein 3 | A | protein | 173 | Homo sapiens | Q96B67 (AlphaFold model) |
>4R7V_1 Arrestin domain-containing protein 3 (chains A) MVLGKVKSLTISFDCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWT ESRNAGSNTAYTQNYTEEVEYFNHKDILIGHERDDDNSEEGFHTIHSGRHEYAFSFELPQ TPLATSFEGRHGSVRYWVKAELHRPWLLPVKLKKEFTVFEHIDINLEHHHHHH
Insights into beta 2-adrenergic receptor binding from structures of the N-terminal lobe of ARRDC3. Qi, S., O'Hayre, M., Gutkind, J.S. et al. Protein Sci (2014) 23:1708-1716. DOI 10.1002/pro.2549 · PubMed
Other PDB entries of the same protein (UniProt Q96B67 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4R7V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.