4RCW: Human Slitrk1

Crystal structure of human Slitrk1. Determined by X-ray diffraction at 3.19 Å resolution. Released 19 Nov 2014.

Method: X-ray diffraction
Resolution: 3.19 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,725
Mol. weight: 54.65 kDa
Released: 19 Nov 2014

Explore 4RCW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4RCW contains 15 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	346-349	4	1
β-strand	355-358	4	1
β-strand	377-381	5	1
β-strand	389-390	2	2
α-helix	392-395	4
β-strand	403-405	3	1
β-strand	413-414	2	2
β-strand	427-429	3	1
β-strand	437-438	2	3
α-helix	441-443	3
β-strand	451-453	3	1
β-strand	461-462	2	3
α-helix	466-468	3
β-strand	475-477	3	1
β-strand	498-500	3	1
α-helix	511-515	5
β-strand	523-525	3	1
β-strand	531-532	2	4
α-helix	538-545	8
β-strand	552	1	1
β-strand	557	1	5
β-strand	558-560	3	4
α-helix	562-564	3
β-strand	568	1	5
α-helix	574-577	4

Chain B: 8 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	346-348	3	6
β-strand	356-358	3	6
β-strand	379-383	5	6
β-strand	389-390	2	7
α-helix	392-394	3
β-strand	403-407	5	6
β-strand	413-414	2	7
β-strand	427-429	3	6
β-strand	437-438	2	8
α-helix	441-443	3
β-strand	451-453	3	6
β-strand	461-462	2	8
α-helix	466-468	3
β-strand	475-477	3	6
β-strand	498-500	3	6
α-helix	511-515	5
β-strand	523-525	3	6
β-strand	531-532	2	9
α-helix	538-545	8
β-strand	552	1	6
α-helix	555-556	2
β-strand	557	1	10
β-strand	558-560	3	9
α-helix	562-564	3
β-strand	568	1	10
α-helix	574-577	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SLIT and NTRK-like protein 1	A, B	protein	240	Homo sapiens	Q96PX8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4RCW_1 SLIT and NTRK-like protein 1 (chains A, B)
CPGGCSCDHIPGSGLKMNCNNRNVSSLADLKPKLSNVQELFLRDNKIHSIRKSHFVDYKN
LILLDLGNNNIATVENNTFKNLLDLRWLYMDSNYLDTLSREKFAGLQNLEYLNVEYNAIQ
LILPGTFNAMPKLRILILNNNLLRSLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTS
IIQIDLHGNPWECSCTIVPFKQWAERLGSEVLMSDLKCETPVNFFRKDFMLLSNDEICPQ

Primary citation

Structural basis for LAR-RPTP/Slitrk complex-mediated synaptic adhesion. Um, J.W., Kim, K.H., Park, B.S. et al. Nat Commun (2014) 5:5423-5423. DOI 10.1038/ncomms6423 · PubMed

Other PDB entries of the same protein (UniProt Q96PX8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4RCA 2.99 Å, Crystal structure of human PTPdelta and human Slitrk1 complex

Browse structure collections

About this viewer

MolViewer shows 4RCW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.