4REX: First WW domain of human YAP2 isoform

Crystal structure of the first WW domain of human YAP2 isoform. Determined by X-ray diffraction at 1.6 Å resolution. Released 19 Aug 2015.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 432
Mol. weight: 5.63 kDa
Released: 19 Aug 2015

Explore 4REX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4REX contains 3 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	167-168	2
α-helix	172-174	3
β-strand	177-181	5	1
β-strand	187-191	5	1
β-strand	196-198	3	1
α-helix	202-206	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Yorkie homolog	A	protein	49	Homo sapiens	P46937 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4REX_1 Yorkie homolog (chains A)
GAMGFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQ

Primary citation

Crystal structure of the first WW domain of human YAP2 isoform. Martinez-Rodriguez, S., Bacarizo, J., Luque, I. et al. J Struct Biol (2015) 191:381-387. DOI 10.1016/j.jsb.2015.08.001 · PubMed

Other PDB entries of the same protein (UniProt P46937 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6G6X 1.13 Å, 14-3-3sigma in complex with a P129beta3P mutated YAP pS127 phosphopeptide
3MHR 1.15 Å, 14-3-3 sigma in complex with YAP pS127-peptide
7O07 1.2 Å, 14-3-3sigma covalently bound to peptide (chloroacetamide-Cys interaction)
6G8K 1.25 Å, 14-3-3sigma in complex with a S131beta3S mutated YAP pS127 phosphopeptide
6G8L 1.37 Å, 14-3-3sigma in complex with a L132beta3L mutated YAP pS127 phosphopeptide
8A8Q 1.47 Å, Crystal structure of Protein Scalloped in complex with YAP peptide
6G8J 1.47 Å, 14-3-3sigma in complex with a A130beta3A mutated YAP pS127 phosphopeptide
6G8I 1.6 Å, 14-3-3sigma in complex with a R124beta3R mutated YAP pS127 phosphopeptide
6GEI 1.65 Å, TEAD4 (216-434);E263A+Y429F complexed with yap peptide (60- 100);S94A and myristoate…
6HIK 1.65 Å, X-ray structure of TEAD4(Y429H) mutant) complexed with YAP (wildtype): Molecular and…
8A8R 1.7 Å, Crystal structure of TEAD4 in complex with YAP peptide
6GEC 1.7 Å, TEAD4 (216-434) complexed with yap peptide (60-100);S94A and myristoate (covalently…

Browse structure collections

About this viewer

MolViewer shows 4REX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.