4RMT: D98N Beta-2 Microglobulin mutant

Crystal structure of the D98N Beta-2 Microglobulin mutant. Determined by X-ray diffraction at 1.24 Å resolution. Released 18 Nov 2015.

Method: X-ray diffraction
Resolution: 1.24 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,069
Mol. weight: 12.19 kDa
Released: 18 Nov 2015

Explore 4RMT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4RMT contains 2 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
α-helix	4-5	2
β-strand	6-12	7	2
β-strand	22-30	9	2
β-strand	31	1	1
β-strand	36-41	6	3
β-strand	44-45	2	3
β-strand	51-56	6	2
β-strand	62-69	8	2
β-strand	78-83	6	3
β-strand	91-94	4	3
α-helix	95-96	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-2-microglobulin	A	protein	100	Homo sapiens	P61769 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4RMT_1 Beta-2-microglobulin (chains A)
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKD
WSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRNM

Primary citation

Decoding the Structural Bases of D76N 2-Microglobulin High Amyloidogenicity through Crystallography and Asn-Scan Mutagenesis. de Rosa, M., Barbiroli, A., Giorgetti, S. et al. PLoS One (2015) 10:e0144061-e0144061. DOI 10.1371/journal.pone.0144061 · PubMed

Other PDB entries of the same protein (UniProt P61769 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4E0K 0.97 Å, Crystal Structure of the amyloid-fibril forming peptide KDWSFY derived from human Beta 2…
1K5N 1.09 Å, HLA-B*2709 bound to nona-peptide M9
3MRE 1.1 Å, Crystal Structure of MHC class I HLA-A2 molecule complexed with EBV bmlf1-280-288…
2YXF 1.13 Å, The high resolution crystal structure of beta2-microglobulin under physiological…
8E2Z 1.13 Å, Structures of HLA-B8E76C loaded with long peptides reveal novel features at the…
7NMR 1.15 Å, Crystal structure of beta-2-microglobulin D76S mutant
8ROP 1.15 Å, Crystal structure of HLA B*18:01 in complex with QEIRTFSF, an 8-mer epitope from…
7R7W 1.17 Å, Crystal structure of HLA-B*5301 complex with an HIV-1 Gag-derived epitope QW9 S3T variant
4U1M 1.18 Å, HLA class I micropolymorphisms determine peptide-HLA landscape and dictate differential…
3CZF 1.2 Å, Crystal structure of HLA-B*2709 complexed with the glucagon receptor (GR) peptide…
6Y26 1.2 Å, Crystal structure of HLA-B2705 complexed with the nona-peptide mA
7NMC 1.2 Å, Crystal structure of beta-2-microglobulin D76E mutant

Browse structure collections

About this viewer

MolViewer shows 4RMT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.