A triple mutant in the omega-loop of TEM-1 beta-lactamase changes the substrate profile via a large conformational change and an altered general base for deacylation. Determined by X-ray diffraction at 1.44 Å resolution. Released 4 Mar 2015.
Explore 4RVA in 3D Show helices and sheets RCSB PDB PDBe
4RVA contains 15 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 27-40 | 14 | |
| β-strand | 43-50 | 8 | 1 |
| β-strand | 56-60 | 5 | 1 |
| β-strand | 66-67 | 2 | 2 |
| α-helix | 69-71 | 3 | |
| α-helix | 72-85 | 14 | |
| β-strand | 94-95 | 2 | 3 |
| α-helix | 99-101 | 3 | |
| α-helix | 109-111 | 3 | |
| β-strand | 117-118 | 2 | 3 |
| α-helix | 119-124 | 6 | |
| α-helix | 125-129 | 5 | |
| α-helix | 132-142 | 11 | |
| α-helix | 145-154 | 10 | |
| α-helix | 168-170 | 3 | |
| β-strand | 180-181 | 2 | 2 |
| α-helix | 183-195 | 13 | |
| α-helix | 201-212 | 12 | |
| α-helix | 221-224 | 4 | |
| α-helix | 225-226 | 2 | |
| β-strand | 230-237 | 8 | 1 |
| β-strand | 244-251 | 8 | 1 |
| β-strand | 259-266 | 8 | 1 |
| α-helix | 272-288 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta-lactamase TEM | A | protein | 263 | Escherichia coli | P62593 (AlphaFold model) |
>4RVA_1 Beta-lactamase TEM (chains A) HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVD AGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGP KELTAFLHNMGDHVTRLDRYYGELNEAIPNDERDTTMPAAMATTLRKLLTGELLTPASRQ QLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTG SQATMDERNRQIAEIGASLIKHW
| ID | Name | Formula | Copies |
|---|---|---|---|
| BCT | Bicarbonate ion | C H O3 | 1 |
A Triple Mutant in the Omega-loop of TEM-1 beta-Lactamase Changes the Substrate Profile via a Large Conformational Change and an Altered General Base for Catalysis. Stojanoski, V., Chow, D.C., Hu, L. et al. J Biol Chem (2015) 290:10382-10394. DOI 10.1074/jbc.M114.633438 · PubMed
Other PDB entries of the same protein (UniProt P62593 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4RVA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.