4RXJ: WHSC1L1-PWWP2

crystal structure of WHSC1L1-PWWP2. Determined by X-ray diffraction at 2.1 Å resolution. Released 28 Jan 2015.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 927
Mol. weight: 13.22 kDa
Released: 28 Jan 2015

Explore 4RXJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4RXJ contains 4 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	963-969	7	1
β-strand	972-978	7	1
α-helix	979-980	2
α-helix	986-989	4
β-strand	997-1002	6	1
β-strand	1007-1012	6	1
α-helix	1013-1015	3
β-strand	1016-1018	3	1
α-helix	1025-1062	38

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone-lysine N-methyltransferase NSD3	A	protein	113	Homo sapiens	Q9BZ95 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4RXJ_1 Histone-lysine N-methyltransferase NSD3 (chains A)
GKAGKKLHYKQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDLGDFPVFFFGSHDYYWV
HQGRVFPYVEGDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIE

Primary citation

Histone and DNA binding ability studies of the NSD subfamily of PWWP domains. Zhang, M., Yang, Y., Zhou, M. et al. Biochem Biophys Res Commun (2021) 569:199-206. DOI 10.1016/j.bbrc.2021.07.017 · PubMed

Other PDB entries of the same protein (UniProt Q9BZ95 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6G25 1.43 Å, X-ray structure of NSD3-PWWP1 in complex with compound 4
4GNE 1.47 Å, Crystal Structure of NSD3 tandem PHD5-C5HCH domains complexed with H3 peptide 1-7
4GNF 1.55 Å, Crystal Structure of NSD3 tandem PHD5-C5HCH domains complexed with H3 peptide 1-15
6CEN 1.61 Å, Crystal Structure of WHSC1L1 in Complex with Inhibitor PEP21
6G2B 1.61 Å, X-ray structure of NSD3-PWWP1 in complex with compound 8
6G27 1.65 Å, X-ray structure of NSD3-PWWP1 in complex with compound 5
6G29 1.7 Å, X-ray structure of NSD3-PWWP1 in complex with compound 6
4GNG 1.73 Å, Crystal Structure of NSD3 tandem PHD5-C5HCH domains complexed with H3K9me3 peptide
6G2F 1.74 Å, X-ray structure of NSD3-PWWP1 in complex with compound 16
6G2C 1.76 Å, X-ray structure of NSD3-PWWP1 in complex with compound 9
5UPD 1.8 Å, Methyltransferase domain of human Wolf-Hirschhorn Syndrome Candidate 1-Like protein 1…
6G2O 1.81 Å, X-ray structure of NSD3-PWWP1 in complex with compound BI-9321

Browse structure collections

About this viewer

MolViewer shows 4RXJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.