4S14: Nuclear receptor ROR-gamma

Crystal structure of the orphan nuclear receptor RORgamma ligand-binding domain in complex with 4alpha-caboxyl, 4beta-methyl-zymosterol (4ACD8). Determined by X-ray diffraction at 3.54 Å resolution. Released 11 Feb 2015.

Method: X-ray diffraction
Resolution: 3.54 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,107
Mol. weight: 31.74 kDa
Ligands: 4D8
Released: 11 Feb 2015

Explore 4S14 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4S14 contains 18 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	267-283	17
α-helix	289-294	6
α-helix	295-297	3
β-strand	299	1	1
α-helix	300-301	2
α-helix	302-309	8
α-helix	313-337	25
α-helix	346-364	19
α-helix	365-367	3
β-strand	369-370	2	1
β-strand	375-378	4	1
β-strand	381-383	3	1
α-helix	385-391	7
α-helix	394-409	16
α-helix	414-425	12
α-helix	436-456	21
α-helix	462-465	4
α-helix	467-468	2
α-helix	469-489	21
α-helix	491-496	6
α-helix	500-506	7

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	499-504	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear receptor ROR-gamma	A	protein	259	Homo sapiens	P51449 (AlphaFold model)
Nuclear receptor-interacting protein 1	C	protein	12	Homo sapiens	P48552 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4S14_1 Nuclear receptor ROR-gamma (chains A)
GSAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWER
CAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFE
GKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKV
EQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFP
PLYKELFSTETESPVGLSK

Sequence of entity 2 (C), FASTA

>4S14_2 Nuclear receptor-interacting protein 1 (chains C)
TLLQLLLGHKNE

Ligands and cofactors

ID	Name	Formula	Copies
4D8	(3beta,4alpha,5beta,14beta)-3-hydroxy-4-methylcholesta-8,24-diene-4-carboxylic…	C29 H46 O3	1

Primary citation

Identification of Natural ROR gamma Ligands that Regulate the Development of Lymphoid Cells. Santori, F.R., Huang, P., van de Pavert, S.A. et al. Cell Metab (2015) 21:286-297. DOI 10.1016/j.cmet.2015.01.004 · PubMed

Other PDB entries of the same protein (UniProt P51449 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NPC 1.47 Å, ROR(gamma)t ligand binding domain in complex with allosteric ligand FM156
6T4X 1.48 Å, ROR(gamma)t ligand binding domain in complex with 25-hydroxycholesterol and allosteric…
5APH 1.54 Å, Ligand complex of RORg LBD
6R7K 1.54 Å, Ligand complex of RORg LBD
7NP5 1.55 Å, ROR(gamma)t ligand binding domain in complex with allosteric ligand FM216
6W9I 1.61 Å, Substituted benzyloxytricyclic compounds as retinoic acid-related orphan receptor gamma…
6SAL 1.61 Å, ROR(gamma)t ligand binding domain in complex with allosteric ligand FM26
7OFK 1.61 Å, Ligand complex of RORg LBD
6T4T 1.62 Å, ROR(gamma)t ligand binding domain in complex with 20-alpha-hydroxycholesterol and…
7KXD 1.62 Å, Crystal structure of rar-related orphan receptor C (nhis-RORGT(244-487)-L6-SRC1(678-692))…
9N9L 1.64 Å, An RORgt Inverse agonist for treatment of Psoriasis
5NTW 1.64 Å, Structural states of RORgt: X-ray elucidation of molecular mechanisms and binding…

Browse structure collections

About this viewer

MolViewer shows 4S14 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.