4S3H: S. pombe Mdb1 FHA domain

Crystal structure of S. pombe Mdb1 FHA domain. Determined by X-ray diffraction at 2.7 Å resolution. Released 22 Jul 2015.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Schizosaccharomyces pombe 972h-
Chains: 4
Atoms: 2,918
Mol. weight: 57.58 kDa
Released: 22 Jul 2015

Explore 4S3H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4S3H contains 2 α-helices and 53 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	8-11	4	1
β-strand	16-20	5	2
β-strand	27	1	2
β-strand	34-41	8	2
β-strand	44-49	6	2
β-strand	54-56	3	3
β-strand	59-60	2	3
β-strand	63	1	2
β-strand	69-73	5	2
β-strand	80-82	3	3
β-strand	85-86	2	3
β-strand	87-90	4	1

Chain B: 1 helix, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	4
β-strand	8-11	4	4
β-strand	16-19	4	5
β-strand	26-27	2	5
β-strand	36-41	6	5
β-strand	44-49	6	5
β-strand	54-56	3	6
β-strand	59-60	2	6
β-strand	63	1	5
β-strand	68-71	4	2
β-strand	72-73	2	5
α-helix	77-79	3
β-strand	80-82	3	6
β-strand	85-86	2	6
β-strand	87-90	4	4

Chain C: 0 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	7
β-strand	8-11	4	7
β-strand	16-20	5	8
β-strand	27	1	8
β-strand	34-41	8	8
β-strand	44-49	6	8
β-strand	54-56	3	7
β-strand	59-60	2	7
β-strand	63	1	8
β-strand	68-71	4	9
β-strand	72-73	2	8
β-strand	80-82	3	7
β-strand	85-89	5	7

Chain D: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	10
β-strand	8-11	4	10
β-strand	16-19	4	9
α-helix	20	1
β-strand	27	1	9
β-strand	36-41	6	9
β-strand	44-49	6	9
β-strand	54-56	3	11
β-strand	59-60	2	11
β-strand	63	1	9
β-strand	69-73	5	9
β-strand	80-82	3	11
β-strand	85-86	2	11
β-strand	87-89	3	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mdb1	A, B, C, D	protein	126	Schizosaccharomyces pombe 972h-	O14079 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4S3H_1 Mdb1 (chains A, B, C, D)
MGSSHHHHHHSSGLEVLFQGPHMEIQFGNQRCRMVNSGGFLATDGSHLKEMETDDVLVEF
LNIEHQLFIRNIRAIVKIADTTVLPSASDKKLLYYVFDETRVRINDTPVIFSKLEEDNAN
VNEGSK

Primary citation

Dimerization Mediated by a Divergent Forkhead-associated Domain Is Essential for the DNA Damage and Spindle Functions of Fission Yeast Mdb1. Luo, S., Xin, X., Du, L.L. et al. J Biol Chem (2015) 290:21054-21066. DOI 10.1074/jbc.M115.642538 · PubMed

Other PDB entries of the same protein (UniProt O14079 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7P0J 1.48 Å, Crystal structure of S.pombe Mdb1 BRCT domains
6HM4 1.77 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Mdb1 phosphopeptide
7P0L 1.97 Å, Crystal structure of S.pombe Mdb1 BRCT domains in complex with a H2A phosphopeptide

Browse structure collections

About this viewer

MolViewer shows 4S3H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.