7P0J: S.pombe Mdb1 BRCT domains

Crystal structure of S.pombe Mdb1 BRCT domains. Determined by X-ray diffraction at 1.48 Å resolution. Released 13 Jul 2022.

Method: X-ray diffraction
Resolution: 1.48 Å
Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Chains: 1
Atoms: 1,918
Mol. weight: 22.96 kDa
Ligands: CIT, MG
Released: 13 Jul 2022

Explore 7P0J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7P0J contains 15 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	388-392	5	1
α-helix	398-406	9
β-strand	410-411	2	1
β-strand	421-424	4	1
α-helix	425	1
α-helix	429	1
α-helix	433-441	9
β-strand	445-447	3	1
α-helix	449-457	9
α-helix	463-466	4
β-strand	467	1	1
α-helix	471-477	7
β-strand	494-497	4	2
α-helix	499-504	6
α-helix	508-519	12
α-helix	522	1
β-strand	523-525	3	2
α-helix	530-532	3
α-helix	536	1
β-strand	537-539	3	2
α-helix	546-554	9
β-strand	559	1	2
α-helix	562-570	9
α-helix	575-578	4
β-strand	579	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA damage response protein Mdb1	A	protein	199	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	O14079 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7P0J_1 DNA damage response protein Mdb1 (chains A)
MNKHTNLVTSSFNLTKPMKSFIRRNGLRVQESVTDETDFVILGSPPLRRTHKFLLATSLG
IPLVSSQYLTDCIKSGKVLDFRSYKYKDEEAEAKWGFRLDDIHRRTCFNGKRLYITKAIR
DSMVGDSIHGLYSILETSGAEIVGDIKRAQEKDTIILAQPDNDQEGRNMSATGLNVYKIE
LVALSILRDRIDFDEFLID

Ligands and cofactors

ID	Name	Formula	Copies
CIT	Citric acid	C6 H8 O7	1
MG	Magnesium ion	Mg	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Phosphorylation-dependent assembly of DNA damage response systems and the central roles of TOPBP1. Day, M., Oliver, A.W., Pearl, L.H. DNA Repair (Amst) (2021) 108:103232-103232. DOI 10.1016/j.dnarep.2021.103232 · PubMed

Other PDB entries of the same protein (UniProt O14079 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HM4 1.77 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Mdb1 phosphopeptide
7P0L 1.97 Å, Crystal structure of S.pombe Mdb1 BRCT domains in complex with a H2A phosphopeptide
4S3H 2.7 Å, Crystal structure of S. pombe Mdb1 FHA domain

Browse structure collections

About this viewer

MolViewer shows 7P0J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.