4TLM: GluN1/GluN2B NMDA receptor, structure 2

Crystal structure of GluN1/GluN2B NMDA receptor, structure 2. Determined by X-ray diffraction at 3.77 Å resolution. Released 2 Jul 2014.

Method: X-ray diffraction
Resolution: 3.77 Å
Organism: Xenopus laevis
Chains: 4
Atoms: 19,547
Mol. weight: 374.11 kDa
Ligands: JEG, QEM, 1AC, NAG
Released: 2 Jul 2014

Explore 4TLM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4TLM contains 143 α-helices and 130 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 38 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	26-33	8	1
α-helix	36-51	16
β-strand	59-66	8	1
α-helix	67-68	2
α-helix	71-77	7
α-helix	78-82	5
α-helix	83-85	3
β-strand	90-92	3	1
α-helix	106-114	9
β-strand	118-120	3	1
α-helix	126-128	3
β-strand	137-139	3	1
α-helix	145-147	3
α-helix	148-158	11
β-strand	164-168	5	2
α-helix	171-186	16
β-strand	194-197	4	2
α-helix	205-213	9
β-strand	218-222	5	2
α-helix	225-237	13
β-strand	246-249	4	2
α-helix	251-254	4
α-helix	257-261	5
α-helix	262-263	2
β-strand	267-271	5	2
α-helix	278-295	18
α-helix	303-305	3
α-helix	317-326	10
β-strand	339-340	2	3
β-strand	346-347	2	3
β-strand	351-355	5	2
α-helix	357-359	3
β-strand	362-368	7	2
β-strand	371-374	4	2
α-helix	378-379	2
β-strand	397-401	5	4
β-strand	410-412	3	4
α-helix	413-414	2
β-strand	424	1	5
β-strand	430	1	5
α-helix	431-432	2
β-strand	434-439	6	4
β-strand	448-454	7	4
α-helix	456-467	12
β-strand	471-474	4	4
β-strand	484	1	6
β-strand	497	1	6
α-helix	499-505	7
β-strand	510-511	2	4
β-strand	516	1	7
α-helix	519-522	4
β-strand	526-527	2	4
α-helix	528-530	3
β-strand	532-541	10	7
α-helix	558-581	24
α-helix	592-605	14
α-helix	617-645	29
α-helix	660-663	4
β-strand	671-672	2	7
α-helix	678-685	8
α-helix	690-697	8
α-helix	704-713	10
β-strand	718-722	5	7
α-helix	723-733	11
β-strand	736-748	13	7
β-strand	751-752	2	4
α-helix	758-771	14
α-helix	774-782	9
α-helix	795-797	3
α-helix	800-832	33

Chain B: 35 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	29-37	9	8
β-strand	60-68	9	8
α-helix	73-84	12
β-strand	91-96	6	8
α-helix	103-114	12
β-strand	118-120	3	8
α-helix	123-126	4
α-helix	131-133	3
β-strand	138-140	3	8
α-helix	143-144	2
α-helix	145-158	14
β-strand	163-169	7	9
α-helix	176-187	12
β-strand	193-200	8	9
α-helix	210-215	6
β-strand	222-226	5	9
α-helix	229-242	14
β-strand	250-253	4	9
α-helix	255-258	4
α-helix	269	1
β-strand	273-276	4	9
α-helix	284-306	23
α-helix	319-321	3
α-helix	325-327	3
α-helix	328-334	7
β-strand	338-339	2	10
β-strand	342-343	2	10
β-strand	346	1	11
β-strand	351	1	8
β-strand	352	1	11
β-strand	357-362	6	9
β-strand	368-375	8	9
β-strand	378-381	4	9
β-strand	399-403	5	12
β-strand	406	1	12
β-strand	410-413	4	12
α-helix	414-416	3
β-strand	427-430	4	12
β-strand	447-452	6	12
α-helix	453-465	13
β-strand	469-473	5	12
β-strand	483	1	13
β-strand	486	1	13
α-helix	490-495	6
β-strand	501-502	2	12
α-helix	510-515	6
α-helix	519-521	3
β-strand	525	1	14
β-strand	527-531	5	15
α-helix	545-547	3
α-helix	550-569	20
α-helix	586-596	11
α-helix	609-638	30
α-helix	663-664	2
β-strand	666-667	2	15
α-helix	673-681	9
α-helix	683-689	7
α-helix	690-692	3
α-helix	697-705	9
β-strand	711-715	5	15
α-helix	716-724	9
β-strand	732-733	2	15
α-helix	738-739	2
β-strand	743	1	14
α-helix	757-768	12
α-helix	771-775	5
α-helix	776-780	5
α-helix	799-827	29

Chain C: 35 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	26-33	8	16
α-helix	36-51	16
β-strand	59-66	8	16
α-helix	67-68	2
α-helix	71-77	7
α-helix	78-82	5
α-helix	83-85	3
β-strand	90-92	3	16
α-helix	106-114	9
β-strand	118-120	3	16
α-helix	126-128	3
β-strand	137-139	3	16
α-helix	147-158	12
β-strand	164-168	5	17
α-helix	171-186	16
β-strand	194-197	4	17
α-helix	205-213	9
β-strand	218-222	5	17
α-helix	225-237	13
β-strand	246-249	4	17
α-helix	251-254	4
α-helix	257-261	5
α-helix	262-263	2
β-strand	267-271	5	17
α-helix	277-295	19
α-helix	303-305	3
α-helix	317-326	10
β-strand	340	1	18
β-strand	346	1	18
β-strand	351-355	5	17
α-helix	357-359	3
β-strand	362-368	7	17
β-strand	371-374	4	17
α-helix	378-379	2
β-strand	397-401	5	19
β-strand	410-412	3	19
α-helix	413-414	2
β-strand	424	1	20
β-strand	430	1	20
α-helix	431-432	2
β-strand	434-439	6	19
β-strand	448-454	7	19
α-helix	456-467	12
β-strand	471-474	4	19
β-strand	510-511	2	19
β-strand	516	1	21
α-helix	519-524	6
β-strand	526-527	2	19
α-helix	528-530	3
β-strand	532-538	7	21
α-helix	558-581	24
α-helix	593-605	13
α-helix	617-644	28
α-helix	660-663	4
β-strand	672	1	22
α-helix	678-685	8
α-helix	690-697	8
α-helix	704-713	10
β-strand	719	1	22
β-strand	720-722	3	21
α-helix	723-733	11
β-strand	739-748	10	21
β-strand	751-752	2	19
α-helix	758-771	14
α-helix	774-782	9
α-helix	800-825	26

Chain D: 35 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	31-37	7	23
α-helix	45-50	6
α-helix	60-61	2
β-strand	62-68	7	23
α-helix	73-87	15
β-strand	91-96	6	23
α-helix	102-114	13
β-strand	118-120	3	23
α-helix	123-126	4
α-helix	131-133	3
β-strand	138-140	3	23
α-helix	143-144	2
α-helix	145-158	14
β-strand	163-169	7	24
α-helix	176-187	12
β-strand	193-200	8	24
α-helix	210-215	6
β-strand	222-226	5	24
α-helix	229-242	14
β-strand	250-253	4	24
α-helix	255-258	4
α-helix	269	1
β-strand	273-276	4	24
α-helix	284-306	23
α-helix	319-321	3
α-helix	327-334	8
β-strand	338-339	2	25
β-strand	342-343	2	25
β-strand	346	1	26
β-strand	351	1	23
β-strand	352	1	26
β-strand	357-362	6	24
β-strand	368-375	8	24
β-strand	378-381	4	24
β-strand	400-403	4	27
β-strand	406	1	28
β-strand	410	1	28
β-strand	411-413	3	27
α-helix	414-416	3
β-strand	427-430	4	27
β-strand	447-451	5	27
α-helix	453-465	13
β-strand	470-473	4	27
β-strand	481-483	3	29
β-strand	486-488	3	29
α-helix	490-495	6
β-strand	501-502	2	27
α-helix	510-515	6
α-helix	519-521	3
β-strand	525	1	30
β-strand	527-531	5	31
α-helix	545-547	3
α-helix	550-569	20
α-helix	584-596	13
α-helix	609-637	29
α-helix	663-664	2
β-strand	666-667	2	31
α-helix	673-681	9
α-helix	683-689	7
α-helix	690-692	3
α-helix	697-705	9
β-strand	711-715	5	31
α-helix	716-724	9
β-strand	732-733	2	31
β-strand	743	1	30
α-helix	757-768	12
α-helix	771-775	5
α-helix	776-780	5
α-helix	799-827	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
receptor subunit GluN1	A, C	protein	823	Xenopus laevis	A0A1L8F5J9 (AlphaFold model)
receptor subunit GluN2B	B, D	protein	824	Xenopus laevis	A7XY94 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4TLM_1 receptor subunit GluN1 (chains A, C)
ADPKIVNIGAVLSTKKHEQIFREAVNQANFFHFTRKIQLNATSVTHRPNAIQMALSVCED
LISSQVYAILVSHPPAPTDHLTPTPISYTAGFYRIPVIGLTTRMSIYSDKSIHLSFLRTV
PPYSHQALVWFEMMRLFNWNHVILIVSDDHEGRAAQKKLETLLEEKESKADKVLQFEPGT
KNLTALLLEAKELEARVIILSASEDDATAVYKSAAMLDMTGAGYVWLVGEREISGSALRY
APDGIIGLQLINGKNESAHISDAVAVVAQAIHELFEMEQITDPPRGCVGNTNIWKTGPLF
KRVLMSSKYPDGVTGRIEFNEDGDRKFAQYSIMNLQNRKLVQVGIFDGSYIIQNDRKIIW
PGGETERPQGYQMSTRLKIVTIHQEPFVYVRPTTSDGTCREEYTINGDPIKKVICNGPDE
TIPGRPTVPQCCYGFCVDLLIKLAREMDFTYEVHLVADGKFGTQERVNNSNAAAWNGMMG
ELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLW
LLVGLSVHVVAVMLYLLDRFSPFGRFEDALTLSSAMWFSWRVLLNSGLGEGAPRSFSARI
LGMVWAGFAMIIVASYTANLAAFLVLRRPEERITGINDPRLRNPSDKFIYATVKQSSVDI
YFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGE
LFFRSGFGIGMRKDSPWKQEVSLNILKSHENGFMEELDKTWVRYQECDSRSNAPATLTFE
NMAGVFMLVAGGIVAGIFLIFIEIAYKSRAEAKRMKGLEVLFQ

Sequence of entity 2 (B, D), FASTA

>4TLM_2 receptor subunit GluN2B (chains B, D)
SRAYAQKHPNMDIAVILVGTTEEVAIKDVHEKDDFHHLPVTPRVELVTMQESDPKSIITR
ICDLMSDKKVQGVVFGDDTDQEAIAQILDFISVQTLTPILGIHGGSSMIMADKEEASMFF
QFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFENKVRSTIENSFVGWELEEVIH
LDMSLDDIDSKIQNQLCKLQSPVILLYCTKEEATYIFEVAHSVGLTGYGFTWIVPSLVAG
DTDTVPDEFPTGLISVSYDEWDYDLPARVRDGIAIITTAASTMLSEHNSIPQSKSSCNNI
QESRVYEAHMLKRYLINVTFEGRDLSFSEDGYQMHPKLVIILLNQERKWERVGKYKDRSL
KMWPVFDLYPNSEEHKDEHLSIVTLEEAPFVIVEDVDPLSGTCMRNTVPCRKQIRPENRT
EEGGNYIKRCCKGFCIDILKKIAKTVKFTYDLYLVTNGKHGKKINGVWNGMIGEVVTKRA
YMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVML
LIVSAVAVFVFEYFSPVGYNGPSFTIGKAIWLLWGLVFNNSLPVQNPKGTTSKIMVSVWA
FFAVIFLASYTANLAAFMIQRRYVDQVSGLSDKKFQRPNDFSPAFRFGTVPNGSTERNIR
NNYLEMHSYMVKFNQRSVQDALLSLKSGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKV
FATTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELEALWLTGICHNEKNEVMSSQLDID
NMAGVFYMLAAAMALSLITFIMEHLFYKSRAEAKRMKGLEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
JEG	trans-1-aminocyclobutane-1,3-dicarboxylic acid	C6 H9 N O4	1
QEM	4-[(1R,2S)-3-(4-benzylpiperidin-1-yl)-1-hydroxy-2-methylpropyl]phenol	C22 H29 N O2	2
1AC	1-aminocyclopropanecarboxylic acid	C4 H7 N O2	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	7

Primary citation

NMDA receptor structures reveal subunit arrangement and pore architecture. Lee, C.H., Lu, W., Michel, J.C. et al. Nature (2014) 511:191-197. DOI 10.1038/nature13548 · PubMed

Other PDB entries of the same protein (UniProt A0A1L8F5J9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3QEK 2.0 Å, Crystal structure of amino terminal domain of the NMDA receptor subunit GluN1
6E7R 2.1 Å, Heterodimer of the GluN1b-GluN2B NMDA receptor amino-terminal domains bound to…
6E7U 2.27 Å, Heterodimer of the GluN1b-GluN2B NMDA receptor amino-terminal domains bound to…
6E7T 2.31 Å, Heterodimer of the GluN1b-GluN2B NMDA receptor amino-terminal domains bound to…
6E7X 2.58 Å, Heterodimer of the GluN1b-GluN2B NMDA receptor amino-terminal domains bound to…
3QEL 2.6 Å, Crystal structure of amino terminal domains of the NMDA receptor subunit GluN1 and…
6E7V 2.6 Å, Heterodimer of the GluN1b-GluN2B NMDA receptor amino-terminal domains bound to…
6E7W 2.67 Å, Heterodimer of the GluN1b-GluN2B NMDA receptor amino-terminal domains bound to…
5TQ0 2.7 Å, Crystal structure of amino terminal domains of the NMDA receptor subunit GluN1 and…
6E7S 2.72 Å, Heterodimer of the GluN1b-GluN2B NMDA receptor amino-terminal domains bound to…
9Q3Y 2.74 Å, GluN1b-GluN2B ATD in complex with radiprodil
5EWM 2.76 Å, Crystal structure of amino terminal domains of the nmda receptor subunit GLUN1 and…

Browse structure collections

About this viewer

MolViewer shows 4TLM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.