Structure of Pin1 PPIase domain bound with all-trans retinoic acid. Determined by X-ray diffraction at 1.33 Å resolution. Released 8 Apr 2015.
Explore 4TNS in 3D Show helices and sheets RCSB PDB PDBe
4TNS contains 10 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 55-62 | 8 | 1 |
| β-strand | 72 | 1 | 2 |
| β-strand | 75 | 1 | 2 |
| α-helix | 82-98 | 17 | |
| α-helix | 103-110 | 8 | |
| α-helix | 114-118 | 5 | |
| β-strand | 121-125 | 5 | 1 |
| α-helix | 132-140 | 9 | |
| α-helix | 142 | 1 | |
| β-strand | 146 | 1 | 1 |
| β-strand | 150-152 | 3 | 1 |
| β-strand | 155-161 | 7 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 54-62 | 9 | 3 |
| β-strand | 72 | 1 | 4 |
| β-strand | 75 | 1 | 4 |
| α-helix | 82-98 | 17 | |
| α-helix | 103-110 | 8 | |
| α-helix | 114-118 | 5 | |
| β-strand | 121-126 | 6 | 3 |
| α-helix | 132-139 | 8 | |
| α-helix | 142 | 1 | |
| β-strand | 146 | 1 | 3 |
| β-strand | 150-152 | 3 | 3 |
| β-strand | 155-161 | 7 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 | A, B | protein | 151 | Homo sapiens | Q13526 (AlphaFold model) |
>4TNS_1 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (chains A, B) MGSSHHHHHHSSGLVPRGSHMLEVLFQGPGSGGKNGQGEPARVRCSHLLVKHSQSRRPSS WRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQK PFEDASFALRTGEMSGPVFTDSGIHIILRTE
| ID | Name | Formula | Copies |
|---|---|---|---|
| REA | Retinoic acid | C20 H28 O2 | 1 |
Structure of Pin1 PPIase domain bound with all-trans retinoic acid. Li, W.Z., Zhang, Y. To be published.
Other PDB entries of the same protein (UniProt Q13526 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4TNS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.