14-3-3 sigma in complex with Pin1 binding site pS72 and covalently bound TCF521-026. Determined by X-ray diffraction at 1.4 Å resolution. Released 16 Jun 2021.
Explore 7AXN in 3D Show helices and sheets RCSB PDB PDBe
7AXN contains 15 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-30 | 12 | |
| α-helix | 35-37 | 3 | |
| α-helix | 38-69 | 32 | |
| α-helix | 80-102 | 23 | |
| α-helix | 103-107 | 5 | |
| α-helix | 108-110 | 3 | |
| α-helix | 114-134 | 21 | |
| α-helix | 140-161 | 22 | |
| α-helix | 167-178 | 12 | |
| α-helix | 179-183 | 5 | |
| α-helix | 187-202 | 16 | |
| α-helix | 205-207 | 3 | |
| α-helix | 210-230 | 21 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 69-71 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 14-3-3 protein sigma | A | protein | 253 | Homo sapiens | P31947 (AlphaFold model) |
| Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 | P | protein | 17 | Homo sapiens | Q13526 (AlphaFold model) |
>7AXN_1 14-3-3 protein sigma (chains A) GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQ RAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAE SRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALN FSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNA GEEGGEAPQEPQS
>7AXN_2 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (chains P) LVKHSQSRRPSSWRQEK
Water and common crystallization additives (CL) are not listed.
Reversible Covalent Imine-Tethering for Selective Stabilization of 14-3-3 Hub Protein Interactions. Cossar, P.J., Wolter, M., van Dijck, L. et al. J Am Chem Soc (2021) 143:8454-8464. DOI 10.1021/jacs.1c03035 · PubMed
Other PDB entries of the same protein (UniProt P31947 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7AXN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.