4TQ1: Human ATG5-TECAIR

Crystal structure of human ATG5-TECAIR. Determined by X-ray diffraction at 1.8 Å resolution. Released 11 Mar 2015.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,615
Mol. weight: 38.88 kDa
Released: 11 Mar 2015

Explore 4TQ1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4TQ1 contains 17 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	4-12	9
β-strand	15-22	8	1
β-strand	35-40	6	1
α-helix	45-48	4
α-helix	50-57	8
β-strand	69-72	4	1
β-strand	75-76	2	1
α-helix	77	1
α-helix	83-91	9
α-helix	95	1
β-strand	98-103	6	1
α-helix	118-137	20
α-helix	140-144	5
α-helix	147-158	12
α-helix	162-172	11
β-strand	187-191	5	2
α-helix	197-198	2
β-strand	199	1	2
β-strand	206	1	3
α-helix	211	1
β-strand	212	1	3
α-helix	213	1
β-strand	214	1	4
α-helix	215-222	8
α-helix	224-226	3
β-strand	227	1	5
β-strand	234	1	5
β-strand	237-239	3	2
β-strand	240	1	6
β-strand	243	1	6
β-strand	250	1	4
α-helix	251-257	7
β-strand	265-270	6	2

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	577-594	18
β-strand	601-602	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Autophagy protein 5	A	protein	289	Homo sapiens	Q9H1Y0 (AlphaFold model)
Tectonin beta-propeller repeat-containing protein 1	B	protein	39	Homo sapiens	Q7Z6L1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4TQ1_1 Autophagy protein 5 (chains A)
MGSSHHHHHHSQGSMTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLT
LVTDKVKKHFQKVMRQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKS
FPEKDLLHCPSKDAIEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFW
AINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSA
IDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD

Sequence of entity 2 (B), FASTA

>4TQ1_2 Tectonin beta-propeller repeat-containing protein 1 (chains B)
MAQTAAWRKQIFQQLTERTKRELENFRHYEQAVEQSVWV

Primary citation

Insights into autophagosome maturation revealed by the structures of ATG5 with its interacting partners. Kim, J.H., Hong, S.B., Lee, J.K. et al. Autophagy (2015) 11:75-87. DOI 10.4161/15548627.2014.984276 · PubMed

Other PDB entries of the same protein (UniProt Q9H1Y0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4NAW 2.19 Å, Crystal Structure of Human ATG12~ATG5-ATG16N in complex with a fragment of ATG3
4TQ0 2.7 Å, Crystal structure of human ATG5-ATG16N69
4GDK 2.7 Å, Crystal Structure of Human Atg12~Atg5 Conjugate in Complex with an N-terminal Fragment…
4GDL 2.88 Å, Crystal Structure of Human Atg12~Atg5 Conjugate in Complex with an N-terminal Fragment…
5D7G 3.0 Å, Structure of human ATG5 E122D-ATG16L1 complex at 3.0 Angstroms
7W36 3.0 Å, Crystal structure of human Atg5 complexed with a stapled peptide
5NPV 3.1 Å, Structure of human ATG5-ATG16L1(ATG5BD) complex (I4)
5NPW 3.1 Å, Structure of human ATG5-ATG16L1(ATG5BD) complex (C2)

Browse structure collections

About this viewer

MolViewer shows 4TQ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.