5NPV: Human ATG5-ATG16L1(ATG5BD) complex

Structure of human ATG5-ATG16L1(ATG5BD) complex (I4). Determined by X-ray diffraction at 3.1 Å resolution. Released 11 Oct 2017.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,634
Mol. weight: 135.96 kDa
Released: 11 Oct 2017

Explore 5NPV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5NPV contains 35 α-helices and 29 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	5-12	8
β-strand	15-22	8	1
β-strand	35-40	6	1
α-helix	45-57	13
β-strand	69-72	4	1
β-strand	75-76	2	1
α-helix	77-78	2
α-helix	83-86	4
α-helix	87-91	5
α-helix	95	1
β-strand	98-103	6	1
α-helix	118-136	19
α-helix	147-158	12
α-helix	162-169	8
α-helix	171-173	3
β-strand	187-191	5	2
β-strand	198-199	2	2
β-strand	206	1	3
α-helix	211	1
β-strand	212	1	3
α-helix	213	1
β-strand	214	1	4
α-helix	215-221	7
α-helix	224-226	3
β-strand	237-239	3	2
β-strand	240	1	5
β-strand	243	1	5
β-strand	250	1	4
α-helix	251-253	3
α-helix	254-258	5
β-strand	265-270	6	2

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	12-28	17
α-helix	30-45	16

Chain C: 14 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	5-12	8
β-strand	15-21	7	6
β-strand	35-40	6	6
α-helix	45-53	9
β-strand	68-71	4	6
β-strand	76	1	6
α-helix	77	1
α-helix	83-86	4
α-helix	87-91	5
α-helix	95	1
β-strand	98-104	7	6
α-helix	118-136	19
α-helix	140-144	5
α-helix	147-158	12
α-helix	162-172	11
β-strand	188-191	4	7
β-strand	206	1	8
α-helix	211	1
β-strand	212	1	8
α-helix	213	1
β-strand	214	1	9
α-helix	215-222	8
β-strand	236-239	4	7
β-strand	240	1	10
β-strand	243	1	10
β-strand	250	1	9
α-helix	251-257	7
β-strand	266-271	6	7

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	12-24	13
α-helix	25-29	5
α-helix	30-46	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Autophagy protein 5	A, C	protein	282	Homo sapiens	Q9H1Y0 (AlphaFold model)
Autophagy-related protein 16-1	B, D	protein	301	Homo sapiens	Q676U5 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>5NPV_1 Autophagy protein 5 (chains A, C)
GAHMSGRMTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVK
KHFQKVMRQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLL
HCPSKDAIEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLM
EYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGE
KKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD

Sequence of entity 2 (B, D), FASTA

>5NPV_2 Autophagy-related protein 16-1 (chains B, D)
GGGRPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNR
HEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQM
NEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEE
NQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDE
TSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGK
E

Primary citation

Identification, biochemical characterization and crystallization of the central region of human ATG16L1. Archna, A., Scrima, A. Acta Crystallogr F Struct Biol Commun (2017) 73:560-567. DOI 10.1107/S2053230X17013280 · PubMed

Other PDB entries of the same protein (UniProt Q9H1Y0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4TQ1 1.8 Å, Crystal structure of human ATG5-TECAIR
4NAW 2.19 Å, Crystal Structure of Human ATG12~ATG5-ATG16N in complex with a fragment of ATG3
4TQ0 2.7 Å, Crystal structure of human ATG5-ATG16N69
4GDK 2.7 Å, Crystal Structure of Human Atg12~Atg5 Conjugate in Complex with an N-terminal Fragment…
4GDL 2.88 Å, Crystal Structure of Human Atg12~Atg5 Conjugate in Complex with an N-terminal Fragment…
5D7G 3.0 Å, Structure of human ATG5 E122D-ATG16L1 complex at 3.0 Angstroms
7W36 3.0 Å, Crystal structure of human Atg5 complexed with a stapled peptide
5NPW 3.1 Å, Structure of human ATG5-ATG16L1(ATG5BD) complex (C2)

Browse structure collections

About this viewer

MolViewer shows 5NPV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.