Crystal Structure of a GDP-bound G13D Oncogenic Mutant of Human GTPase KRas. Determined by X-ray diffraction at 1.13 Å resolution. Released 10 Jun 2015.
Explore 4TQA in 3D Show helices and sheets RCSB PDB PDBe
4TQA contains 10 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-9 | 8 | 1 |
| α-helix | 16-25 | 10 | |
| β-strand | 38-46 | 9 | 1 |
| β-strand | 49-57 | 9 | 1 |
| α-helix | 65-74 | 10 | |
| β-strand | 77-83 | 7 | 1 |
| α-helix | 87-104 | 18 | |
| β-strand | 111-116 | 6 | 1 |
| α-helix | 127-137 | 11 | |
| β-strand | 141-143 | 3 | 1 |
| α-helix | 152-167 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| GTPase KRas | A, B | protein | 169 | Homo sapiens | P01116 (AlphaFold model) |
>4TQA_1 GTPase KRas (chains A, B) GMTEYKLVVVGAGDVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTA GQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCD LPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Biochemical and Structural Analysis of Common Cancer-Associated KRAS Mutations. Hunter, J.C., Manandhar, A., Carrasco, M.A. et al. Mol Cancer Res (2015) 13:1325-1335. DOI 10.1158/1541-7786.MCR-15-0203 · PubMed
Other PDB entries of the same protein (UniProt P01116 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4TQA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.