4TQE: Tau peptide

Structure of tau peptide in complex with Tau5 antibody Fab fragment. Determined by X-ray diffraction at 1.6 Å resolution. Released 29 Jul 2015.

Method: X-ray diffraction
Resolution: 1.6 Å
Organisms: Mus musculus, Homo sapiens
Chains: 3
Atoms: 4,060
Mol. weight: 50.52 kDa
Released: 29 Jul 2015

Explore 4TQE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4TQE contains 21 α-helices and 48 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	223-224	2
β-strand	225	1	8

Chain H: 11 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	7
α-helix	7-9	3
β-strand	10-12	3	2
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	32-40	9	2
β-strand	44-51	8	2
β-strand	58-60	3	2
α-helix	62-64	3
β-strand	65	1	7
β-strand	68-73	6	7
α-helix	74-76	3
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-100	9	2
β-strand	102	1	8
β-strand	108-111	4	2
β-strand	115-119	5	2
α-helix	122-124	3
β-strand	125	1	9
α-helix	126-127	2
β-strand	128-132	5	10
β-strand	143-153	11	10
β-strand	154	1	9
β-strand	159-162	4	11
α-helix	163-165	3
β-strand	167	1	11
β-strand	171-173	3	10
α-helix	174-176	3
β-strand	177-179	3	10
β-strand	182-192	11	10
α-helix	193-195	3
β-strand	202-207	6	11
α-helix	208-210	3
β-strand	212-217	6	11

Chain L: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	30	1	3
β-strand	36	1	3
β-strand	38-43	6	2
β-strand	49-54	6	2
β-strand	58-59	2	2
α-helix	60	1
β-strand	67-72	6	1
β-strand	75-80	6	1
α-helix	85-87	3
β-strand	89-95	7	2
α-helix	101	1
β-strand	102-103	2	2
β-strand	107-111	5	2
β-strand	116	1	4
α-helix	117-118	2
β-strand	119-123	5	5
α-helix	124-126	3
α-helix	127-131	5
β-strand	134-144	11	5
β-strand	145	1	4
β-strand	149-155	7	6
β-strand	158-160	3	6
β-strand	164-168	5	5
α-helix	169-172	4
β-strand	178-187	10	5
α-helix	188-193	6
β-strand	196-203	8	6
α-helix	209	1
β-strand	210-215	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
If kappa light chain	L	protein	218	Mus musculus	A2NHM3 (AlphaFold model)
Fab heavy chain	H	protein	222	Mus musculus
Microtubule-associated protein tau	A	protein	16	Homo sapiens	P10636 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>4TQE_1 If kappa light chain (chains L)
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPWTFGGGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE

Sequence of entity 2 (H), FASTA

>4TQE_2 Fab heavy chain (chains H)
EVQLQQSGAEIVRSGASVKLSCAASGFNIKDYYMHWVKQRPEQGLEWIGWIDPENGDIAY
APKFQGKATMTADTSSNTAYLQLSRLTSEDTAVYFCNGRGGMITTDFFDYWGQGTTLTVS
SAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQS
DLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD

Sequence of entity 3 (A), FASTA

>4TQE_3 Microtubule-associated protein tau (chains A)
LPTPPTREPKKVAVVR

Primary citation

Structure of tau peptide in complex with Tau5 antibody Fab fragment. Cehlar, O., Skrabana, R., Novak, M. To be published.

Other PDB entries of the same protein (UniProt A2NHM3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PXR 1.56 Å, Anti-TAU BIIB092 FAB with TAU peptide
4TPR 1.6 Å, Structure of Tau5 antibody Fab fragment
3V4U 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
3UO1 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
2IPU 1.65 Å, PFA1 Fab fragment complexed with Abeta 1-8 peptide
3V52 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
2DQU 1.7 Å, Crystal form II: high resolution crystal structure of the complex of the hydrolytic…
3UYR 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
1ZEA 1.78 Å, Structure of the anti-cholera toxin antibody Fab fragment TE33 in complex with a D-peptide
1PZ5 1.8 Å, Structural basis of peptide-carbohydrate mimicry in an antibody combining site
2DQT 1.8 Å, High resolution crystal structure of the complex of the hydrolytic antibody Fab 6D9 and…
1T2Q 1.83 Å, The Crystal Structure of an NNA7 Fab that recognizes an N-type blood group antigen

Browse structure collections

About this viewer

MolViewer shows 4TQE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.