6PXR: Anti-TAU BIIB092 FAB with TAU peptide

Anti-TAU BIIB092 FAB with TAU peptide. Determined by X-ray diffraction at 1.56 Å resolution. Released 29 Jul 2020.

Method: X-ray diffraction
Resolution: 1.56 Å
Organisms: Mus musculus, Homo sapiens
Chains: 3
Atoms: 3,734
Mol. weight: 48.77 kDa
Released: 29 Jul 2020

Explore 6PXR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6PXR contains 16 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	11-12	2	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	34-39	6	9
β-strand	45-51	7	9
β-strand	58-59	2	9
β-strand	68-73	6	7
α-helix	74-76	3
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-98	7	9
β-strand	106-107	2	9
β-strand	111-113	3	9
β-strand	114-115	2	8
β-strand	121	1	10
α-helix	122-123	2
β-strand	124-128	5	11
β-strand	139-149	11	11
β-strand	150	1	10
β-strand	155-158	4	12
α-helix	159-161	3
β-strand	167-169	3	11
α-helix	170-172	3
β-strand	173-175	3	11
β-strand	178-188	11	11
β-strand	198-203	6	12
α-helix	204-206	3
β-strand	208-213	6	12

Chain L: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	30	1	3
β-strand	36	1	3
β-strand	38-43	6	2
β-strand	50-54	5	2
β-strand	58-59	2	2
α-helix	60	1
β-strand	67-72	6	1
β-strand	75-80	6	1
α-helix	85-87	3
β-strand	89-95	7	2
α-helix	101	1
β-strand	102-103	2	2
β-strand	107-111	5	2
β-strand	116	1	4
α-helix	117-118	2
β-strand	119-123	5	5
α-helix	124-126	3
α-helix	127-131	5
β-strand	134-144	11	5
β-strand	145	1	4
β-strand	150-155	6	6
β-strand	158-160	3	6
β-strand	164-168	5	5
α-helix	169-172	4
β-strand	178-187	10	5
α-helix	188-192	5
β-strand	196-202	7	6
α-helix	209	1
β-strand	210-215	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
gosuranemab Fab, light chain	L	protein	219	Mus musculus	A2NHM3 (AlphaFold model)
gosuranemab Fab, heavy chain	H	protein	224	Mus musculus
Microtubule-associated protein tau	A	protein	8	Homo sapiens	P10636 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>6PXR_1 gosuranemab Fab, light chain (chains L)
DVLMTQTPLSLPVSLGDQASISCKSSQSIVHSNGNTYLEWYLQKPGQSPKLLVYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGTYYCFQGSLVPWAFGGGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (H), FASTA

>6PXR_2 gosuranemab Fab, heavy chain (chains H)
EVHLVESGGALVKPGGSLKLSCAASGFSFSKYGMSWVRQTPDKRLEWVATISSSGSRTYY
PDSVKGQFTISRDNAKNTLYLQMSSLKSEDTAMYYCSISWDGAMDYWGQGTSVTVSSAKT
TPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYT
LSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPC

Sequence of entity 3 (A), FASTA

>6PXR_3 Microtubule-associated protein tau (chains A)
AGTYGLGD

Primary citation

Characterization of tau binding by gosuranemab. Sopko, R., Golonzhka, O., Arndt, J. et al. Neurobiol Dis (2020) 146:105120-105120. DOI 10.1016/j.nbd.2020.105120 · PubMed

Other PDB entries of the same protein (UniProt A2NHM3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4TPR 1.6 Å, Structure of Tau5 antibody Fab fragment
4TQE 1.6 Å, Structure of tau peptide in complex with Tau5 antibody Fab fragment
3V4U 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
3UO1 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
2IPU 1.65 Å, PFA1 Fab fragment complexed with Abeta 1-8 peptide
3V52 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
2DQU 1.7 Å, Crystal form II: high resolution crystal structure of the complex of the hydrolytic…
3UYR 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
1ZEA 1.78 Å, Structure of the anti-cholera toxin antibody Fab fragment TE33 in complex with a D-peptide
1PZ5 1.8 Å, Structural basis of peptide-carbohydrate mimicry in an antibody combining site
2DQT 1.8 Å, High resolution crystal structure of the complex of the hydrolytic antibody Fab 6D9 and…
1T2Q 1.83 Å, The Crystal Structure of an NNA7 Fab that recognizes an N-type blood group antigen

Browse structure collections

About this viewer

MolViewer shows 6PXR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.