4TSV: Human tnf-alpha mutant

High resolution crystal structure of a human tnf-alpha mutant. Determined by X-ray diffraction at 1.8 Å resolution. Released 30 Dec 1998.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,187
Mol. weight: 16.58 kDa
Released: 30 Dec 1998

Explore 4TSV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4TSV contains 2 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	1
β-strand	28-29	2	1
β-strand	36-38	3	1
β-strand	42-44	3	2
β-strand	47-49	3	2
α-helix	50	1
β-strand	54-67	14	1
β-strand	76-83	8	2
β-strand	90-98	9	2
β-strand	113-126	14	1
β-strand	131-136	6	2
α-helix	139-141	3
β-strand	142	1	1
β-strand	151-155	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor-alpha	A	protein	150	Homo sapiens	P01375 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4TSV_1 TUMOR NECROSIS FACTOR-ALPHA (chains A)
PSDKPVAHVVANPQAEGQLQWSNRRANALLANGVELRDNQLVVPIEGLFLIYSQVLFKGQ
GCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLE
KGDRLSAEINRPDYLDFAESGQVYFGIIAL

Primary citation

High resolution crystal structure of a human tumor necrosis factor-alpha mutant with low systemic toxicity. Cha, S.S., Kim, J.S., Cho, H.S. et al. J Biol Chem (1998) 273:2153-2160. DOI 10.1074/jbc.273.4.2153 · PubMed

Other PDB entries of the same protein (UniProt P01375 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9OJO 1.36 Å, Crystal structure of TNF alpha in complex with compound 1
5UUI 1.4 Å, Crystal Structure of Spin-Labeled T77C TNFa
4Y6O 1.6 Å, Human SIRT2 in complex with myristoylated peptide (TNF-alphaK20myr)
2E7A 1.8 Å, TNF Receptor Subtype One-selective TNF Mutant with Antagonistic Activity
9OJS 1.85 Å, Crystal structure of TNF alpha in complex with compound 4
5M2J 1.9 Å, Complex between human TNF alpha and Llama VHH2
9BN7 1.92 Å, X-ray crystal structure of TNFa-VNAR C4 complex
2AZ5 2.1 Å, Crystal Structure of TNF-alpha with a small molecule inhibitor
3L9J 2.1 Å, Selection of a novel highly specific TNFalpha antagonist: Insight from the crystal…
7JRA 2.1 Å, HUMAN TNF-ALPHA IN COMPLEX WITH 2-[5-(3-chloro-4-{[(1R)-1-(2-fluorophenyl)ethyl]amino}qui…
5M2I 2.15 Å, Structure of human Tumor Necrosis Factor (TNF) in complex with the Llama VHH1
7KP9 2.15 Å, asymmetric hTNF-alpha

Browse structure collections

About this viewer

MolViewer shows 4TSV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.