Structure of U2AF65 variant with BRU5G6 DNA. Determined by X-ray diffraction at 1.99 Å resolution. Released 26 Nov 2014.
Explore 4TU9 in 3D Show helices and sheets RCSB PDB PDBe
4TU9 contains 16 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 150-154 | 5 | 1 |
| α-helix | 156-157 | 2 | |
| α-helix | 162-175 | 14 | |
| β-strand | 186-192 | 7 | 1 |
| β-strand | 197-202 | 6 | 1 |
| α-helix | 205-211 | 7 | |
| α-helix | 212-214 | 3 | |
| β-strand | 218-219 | 2 | 2 |
| β-strand | 222-223 | 2 | 2 |
| β-strand | 225-227 | 3 | 1 |
| α-helix | 234-235 | 2 | |
| β-strand | 261-264 | 4 | 3 |
| α-helix | 272-280 | 9 | |
| β-strand | 285-292 | 8 | 3 |
| β-strand | 299-307 | 9 | 3 |
| α-helix | 312-320 | 9 | |
| β-strand | 324-325 | 2 | 4 |
| β-strand | 328-329 | 2 | 4 |
| β-strand | 331-334 | 4 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 146-149 | 4 | |
| β-strand | 150-154 | 5 | 5 |
| α-helix | 156-157 | 2 | |
| α-helix | 162-175 | 14 | |
| β-strand | 186-192 | 7 | 5 |
| β-strand | 197-202 | 6 | 5 |
| α-helix | 205-211 | 7 | |
| α-helix | 212-214 | 3 | |
| β-strand | 218-219 | 2 | 6 |
| β-strand | 222-223 | 2 | 6 |
| α-helix | 224 | 1 | |
| β-strand | 225-227 | 3 | 5 |
| β-strand | 261-264 | 4 | 7 |
| α-helix | 272-280 | 9 | |
| β-strand | 285-292 | 8 | 7 |
| β-strand | 299-307 | 9 | 7 |
| α-helix | 310-312 | 3 | |
| α-helix | 313-320 | 8 | |
| β-strand | 324-325 | 2 | 8 |
| β-strand | 328-329 | 2 | 8 |
| β-strand | 331-334 | 4 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Splicing factor U2AF 65 kDa subunit | A, B | protein | 174 | Homo sapiens | P26368 (AlphaFold model) |
| DNA (5'-d(*up*up*up*up*(bru)p*dg*u)-3') | E, P | DNA | 7 | Homo sapiens |
>4TU9_1 Splicing factor U2AF 65 kDa subunit (chains A, B) GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEF RSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSF GPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
>4TU9_2 DNA (5'-D(*UP*UP*UP*UP*(BRU)P*DG*U)-3') (chains E, P) UUUUUGU
| ID | Name | Formula | Copies |
|---|---|---|---|
| DIO | 1,4-diethylene dioxide | C4 H8 O2 | 5 |
| CPQ | N,n-BIS(3-D-gluconamidopropyl)deoxycholamide | C42 H75 N3 O15 | 1 |
Water and common crystallization additives (SO4, GOL) are not listed.
Structure-guided U2AF65 variant improves recognition and splicing of a defective pre-mRNA. Agrawal, A.A., McLaughlin, K.J., Jenkins, J.L. et al. Proc Natl Acad Sci U S A (2014) 111:17420-17425. DOI 10.1073/pnas.1412743111 · PubMed
Other PDB entries of the same protein (UniProt P26368 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4TU9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.