5H7U: EIF3 36-163

NMR structure of eIF3 36-163. Determined by solution NMR. Released 31 May 2017.

Method: Solution NMR
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 1
Atoms: 1,027
Mol. weight: 14.6 kDa
Released: 31 May 2017

Explore 5H7U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5H7U contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	115-118	4
α-helix	139-149	11
α-helix	151-158	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 3 subunit C	A	protein	128	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P32497 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5H7U_1 Eukaryotic translation initiation factor 3 subunit C (chains A)
SESELDQESDDSFFNESESESEADVDSDDSDAKPYGPDWFKKSEFRKQGGGSNKFLKSSN
YDSSDEESDEEDGKKVVKSAKEKLLDEMQDVYNKISQAENSDDWLTISNEFDLISRLLVR
AQQQNWGT

Primary citation

Molecular Landscape of the Ribosome Pre-initiation Complex during mRNA Scanning: Structural Role for eIF3c and Its Control by eIF5. Obayashi, E., Luna, R.E., Nagata, T. et al. Cell Rep (2017) 18:2651-2663. DOI 10.1016/j.celrep.2017.02.052 · PubMed

Other PDB entries of the same protein (UniProt P32497 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8CAH 3.0 Å, Cryo-EM structure of native Otu2-bound ubiquitinated 43S pre-initiation complex
6FYY 3.02 Å, Structure of a partial yeast 48S preinitiation complex with eIF5 N-terminal domain…
8CAS 3.3 Å, Cryo-EM structure of native Otu2-bound ubiquitinated 48S initiation complex (partial)
4U1C 3.5 Å, Crystal structure of the eIF3a/eIF3c PCI-domain heterodimer
6FYX 3.5 Å, Structure of a partial yeast 48S preinitiation complex with eIF5 N-terminal domain…
8S8E 3.85 Å, Structure of a yeast 48S-AUC preinitiation complex in closed conformation (model…
8S8K 4.0 Å, Structure of a yeast 48S-AUC preinitiation complex in swivelled conformation (model…
3JAP 4.9 Å, Structure of a partial yeast 48S preinitiation complex in closed conformation
6GSM 5.15 Å, Structure of a partial yeast 48S preinitiation complex in open conformation.
6ZCE 5.3 Å, Structure of a yeast ABCE1-bound 43S pre-initiation complex
6GSN 5.75 Å, Structure of a partial yeast 48S preinitiation complex in closed conformation
6ZU9 6.2 Å, Structure of a yeast ABCE1-bound 48S initiation complex

Browse structure collections

About this viewer

MolViewer shows 5H7U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.