4U1E: PDB entry 4U1E

Name: PDB 4U1E: Crystal structure of the eIF3b-CTD/eIF3i/eIF3g-NTD translation initiation complex
Published: 2014-09-10
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: translation

Crystal structure of the eIF3b-CTD/eIF3i/eIF3g-NTD translation initiation complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 10 Sept 2014.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Saccharomyces cerevisiae
Chains: 3
Atoms: 3,922
Mol. weight: 60.01 kDa
Released: 10 Sept 2014

Explore 4U1E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4U1E contains 13 α-helices and 35 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	653-689	37

Chain G: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	9
β-strand	17-25	9	9
β-strand	28-36	9	9
α-helix	47-53	7
α-helix	55-57	3
α-helix	59-61	3
α-helix	64-65	2
β-strand	72	1	1
β-strand	77-78	2	1
α-helix	87-95	9

Chain I: 7 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
β-strand	13-18	6	2
β-strand	24-29	6	2
β-strand	34-38	5	2
β-strand	44-48	5	2
β-strand	55-60	6	3
β-strand	66-71	6	3
β-strand	75-80	6	3
β-strand	86-91	6	3
β-strand	96-101	6	4
β-strand	107-112	6	4
α-helix	113	1
β-strand	121-126	6	4
β-strand	127-129	3	5
β-strand	136-139	4	5
β-strand	145-148	4	4
α-helix	154-155	2
β-strand	156-161	6	6
α-helix	163-165	3
β-strand	167-172	6	6
β-strand	177-181	5	6
α-helix	182-184	3
β-strand	187-192	6	6
β-strand	199-204	6	7
β-strand	210-215	6	7
β-strand	219-224	6	7
β-strand	230-235	6	7
β-strand	240-245	6	8
α-helix	246	1
β-strand	251-256	6	8
β-strand	273-279	7	8
β-strand	285-292	8	8
β-strand	296-301	6	1
β-strand	307-312	6	1
β-strand	317-321	5	1
α-helix	324-328	5
α-helix	332-340	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 3 subunit I	I	protein	347	Saccharomyces cerevisiae	A6ZMK5 (AlphaFold model)
Eukaryotic translation initiation factor 3 subunit B	B	protein	47	Saccharomyces cerevisiae	P06103 (AlphaFold model)
Eukaryotic translation initiation factor 3 subunit G	G	protein	138	Saccharomyces cerevisiae	Q04067 (AlphaFold model)

Sequence of entity 1 (I), FASTA

>4U1E_1 Eukaryotic translation initiation factor 3 subunit I (chains I)
MKAIKLTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDV
DCFTKYCVTGSADYSIKLWDVSNGQCVATWKSPVPVKRVEFSPCGNYFLAILDNVMKNPG
SINIYEIERDSATHELTKVSEEPIHKIITHEGLDAATVAGWSTKGKYIIAGHKDGKISKY
DVSNNYEYVDSIDLHEKSISDMQFSPDLTYFITSSRDTNSFLVDVSTLQVLKKYETDCPL
NTAVITPLKEFIILGGGQEAKDVTTTSANEGKFEARFYHKIFEEEIGRVQGHFGPLNTVA
ISPQGTSYASGGEDGFIRLHHFEKSYFDFKYDVEKAAEAKEHMQEAN

Sequence of entity 2 (B), FASTA

>4U1E_2 Eukaryotic translation initiation factor 3 subunit B (chains B)
SNAEADTAMRDLILHQRELLKQWTEYREKIGQEMEKSMNFKIFDVQP

Sequence of entity 3 (G), FASTA

>4U1E_3 Eukaryotic translation initiation factor 3 subunit G (chains G)
SNAMSEVAPEEIIENADGSRSIITYKIEDGVKYKITQKVKEVKVLEKVHKSVAERKNWHK
YGSEKGSPAGPSAVTARLGEEVELRLSRNWKQAEEERIQKEKASLTKTGLQCRLCGNDHM
TMNCPFKTILSELSALED

Primary citation

Molecular Architecture of the 40SeIF1eIF3 Translation Initiation Complex. Erzberger, J.P., Stengel, F., Pellarin, R. et al. Cell (2014) 158:1123-1135. DOI 10.1016/j.cell.2014.07.044 · PubMed

Other PDB entries of the same protein (UniProt A6ZMK5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6FYY 3.02 Å, Structure of a partial yeast 48S preinitiation complex with eIF5 N-terminal domain…

Browse structure collections

About this viewer

MolViewer shows 4U1E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.