4U1F: PDB entry 4U1F

Name: PDB 4U1F: Crystal structure of middle domain of eukaryotic translation initiation factor eIF3b
Published: 2014-09-10
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: translation

Crystal structure of middle domain of eukaryotic translation initiation factor eIF3b. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 Sept 2014.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 7,892
Mol. weight: 113.87 kDa
Released: 10 Sept 2014

Explore 4U1F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4U1F contains 21 α-helices and 90 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 45 β-strands

Element	Residues	Length	Sheet
α-helix	147-150	4
α-helix	152-155	4
β-strand	162-166	5	1
β-strand	170-175	6	1
β-strand	185-190	6	1
β-strand	197-199	3	2
β-strand	206-209	4	2
β-strand	213-218	6	2
β-strand	223-229	7	2
β-strand	233-238	6	3
β-strand	244-249	6	3
α-helix	266-268	3
β-strand	273-277	5	3
β-strand	283-287	5	3
β-strand	301-302	2	4
β-strand	308-313	6	4
β-strand	316-321	6	4
α-helix	322-324	3
β-strand	327-328	2	4
α-helix	329	1
α-helix	332-334	3
β-strand	337	1	4
β-strand	341-344	4	5
β-strand	349	1	6
α-helix	351	1
α-helix	354-355	2
α-helix	359-360	2
β-strand	361	1	6
β-strand	362-368	7	5
β-strand	377-383	7	5
β-strand	388-393	6	5
β-strand	397-404	8	7
β-strand	410-418	9	7
β-strand	425-433	9	7
β-strand	441-445	5	7
β-strand	449-455	7	8
α-helix	456	1
β-strand	462-467	6	8
β-strand	480-487	8	8
β-strand	488	1	9
β-strand	499-508	10	8
β-strand	512-515	4	10
β-strand	521-526	6	10
β-strand	529	1	11
β-strand	532	1	11
β-strand	536-541	6	10
β-strand	543	1	12
β-strand	556	1	9
β-strand	559	1	12
β-strand	561-564	4	10
β-strand	573-576	4	13
β-strand	583-587	5	13
β-strand	597-602	6	14
β-strand	607-612	6	14
β-strand	618-621	4	15

Chain B: 11 helices, 45 β-strands

Element	Residues	Length	Sheet
α-helix	147-150	4
α-helix	152-155	4
β-strand	162-166	5	15
β-strand	170-175	6	15
β-strand	185-190	6	15
β-strand	197-199	3	16
β-strand	206-209	4	16
β-strand	213-218	6	16
β-strand	223-229	7	16
β-strand	233-238	6	17
β-strand	244-249	6	17
α-helix	266-268	3
β-strand	273-277	5	17
β-strand	283-287	5	17
β-strand	300-302	3	18
β-strand	308-313	6	18
β-strand	316-321	6	18
α-helix	322-324	3
β-strand	327-328	2	18
α-helix	329	1
α-helix	332-334	3
β-strand	337	1	18
β-strand	342-344	3	19
β-strand	349	1	20
α-helix	351	1
α-helix	354-355	2
α-helix	359-360	2
β-strand	361	1	20
β-strand	362-368	7	19
β-strand	376-383	8	19
β-strand	388-394	7	19
β-strand	397-404	8	21
β-strand	410-418	9	21
β-strand	425-433	9	21
β-strand	441-445	5	21
β-strand	449-455	7	22
α-helix	456	1
β-strand	462-467	6	22
β-strand	480-487	8	22
β-strand	488	1	23
β-strand	499-508	10	22
β-strand	512-515	4	24
β-strand	521-526	6	24
β-strand	529	1	25
β-strand	532	1	25
β-strand	536-541	6	24
β-strand	543	1	26
β-strand	556	1	23
β-strand	559	1	26
β-strand	561-564	4	24
β-strand	573-576	4	14
β-strand	582-587	6	14
β-strand	597-601	5	13
β-strand	607-612	6	13
β-strand	618-621	4	1
α-helix	622-623	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 3 subunit B	A, B	protein	497	Saccharomyces cerevisiae	P06103 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4U1F_1 Eukaryotic translation initiation factor 3 subunit B (chains A, B)
SNADTEFREPDMPTFVPSSSLKSWLMDDKVRDQFVLQDDVKTSVFWNSMFNEEDSLVESR
ENWSTNYVRFSPKGTYLFSYHQQGVTAWGGPNFDRLRRFYHPDVRNSSVSPNEKYLVTFS
TEPIIVEEDNEFSPFTKKNEGHQLCIWDIASGLLMATFPVIKSPYLKWPLVRWSYNDKYC
ARMVGDSLIVHDATKNFMPLEAKALKPSGIRDFSFAPEGVKLQPFRNGDEPSVLLAYWTP
ETNNSACTATIAEVPRGRVLKTVNLVQVSNVTLHWQNQAEFLCFNVERHTKSGKTQFSNL
QICRLTERDIPVEKVELKDSVFEFGWEPHGNRFVTISVHEVADMNYAIPANTIRFYAPET
KEKTDVIKRWSLVKEIPKTFANTVSWSPAGRFVVVGALVGPNMRRSDLQFYDMDYPGEKN
INDNNDVSASLKDVAHPTYSAATNITWDPSGRYVTAWSSSLKHKVEHGYKIFNIAGNLVK
EDIIAGFKNFAWRPRPA

Primary citation

Molecular Architecture of the 40SeIF1eIF3 Translation Initiation Complex. Erzberger, J.P., Stengel, F., Pellarin, R. et al. Cell (2014) 158:1123-1135. DOI 10.1016/j.cell.2014.07.044 · PubMed

Other PDB entries of the same protein (UniProt P06103 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NS6 1.25 Å, Crystal structure of hte RNA recognition motif of yeast eIF3b residues 76-170
4U1E 2.0 Å, Crystal structure of the eIF3b-CTD/eIF3i/eIF3g-NTD translation initiation complex
3ZWL 2.2 Å, Structure of eukaryotic translation initiation factor eIF3i complex with eIF3b…
3NS5 2.6 Å, Crystal structure of the RNA recognition motif of yeast eIF3b residues 76-161
8CAH 3.0 Å, Cryo-EM structure of native Otu2-bound ubiquitinated 43S pre-initiation complex
6FYY 3.02 Å, Structure of a partial yeast 48S preinitiation complex with eIF5 N-terminal domain…
8CAS 3.3 Å, Cryo-EM structure of native Otu2-bound ubiquitinated 48S initiation complex (partial)
6FYX 3.5 Å, Structure of a partial yeast 48S preinitiation complex with eIF5 N-terminal domain…
3JAP 4.9 Å, Structure of a partial yeast 48S preinitiation complex in closed conformation
6GSM 5.15 Å, Structure of a partial yeast 48S preinitiation complex in open conformation.
6ZCE 5.3 Å, Structure of a yeast ABCE1-bound 43S pre-initiation complex
6GSN 5.75 Å, Structure of a partial yeast 48S preinitiation complex in closed conformation

Browse structure collections

About this viewer

MolViewer shows 4U1F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.