4U7U: RNA-guided immune Cascade complex from E.coli

Crystal structure of RNA-guided immune Cascade complex from E.coli. Determined by X-ray diffraction at 3.0 Å resolution. Released 27 Aug 2014.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Escherichia coli K12, Escherichia coli str. K-12 substr. MG1655
Chains: 24
Atoms: 54,555
Mol. weight: 802.61 kDa
Released: 27 Aug 2014

Explore 4U7U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4U7U contains 370 α-helices and 345 β-strands across 22 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
β-strand	9-13	5	2
β-strand	20-22	3	2
α-helix	24-28	5
β-strand	34-36	3	2
α-helix	41-58	18
α-helix	64-72	9
α-helix	77-84	8
α-helix	85-87	3
β-strand	92	1	1
α-helix	111	1
β-strand	112	1	3
α-helix	113	1
α-helix	114-117	4
β-strand	119	1	4
β-strand	122	1	4
α-helix	127-130	4
β-strand	139	1	5
α-helix	141-151	11
α-helix	156-157	2
β-strand	162	1	6
β-strand	173-176	4	7
α-helix	181-187	7
α-helix	192-198	7
β-strand	206	1	8
α-helix	214-216	3
β-strand	221-222	2	9
α-helix	223-225	3
β-strand	226	1	8
α-helix	228-232	5
β-strand	238-241	4	3
α-helix	242-244	3
β-strand	245	1	10
β-strand	248-249	2	11
β-strand	256-257	2	11
β-strand	260	1	10
β-strand	261	1	5
β-strand	264-267	4	3
β-strand	269	1	6
β-strand	273-274	2	9
β-strand	284-287	4	12
β-strand	294-297	4	12
α-helix	306-308	3
α-helix	310-314	5
β-strand	317	1	12
β-strand	324-326	3	12
α-helix	329-337	9
β-strand	343-353	11	7
β-strand	356-367	12	7
α-helix	369-372	4
α-helix	375-400	26
α-helix	416-437	22
α-helix	440-442	3
α-helix	444-466	23
α-helix	473-491	19

Chain B: 14 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
α-helix	7-15	9
α-helix	19-25	7
α-helix	31-36	6
α-helix	38-44	7
α-helix	45-47	3
α-helix	52-54	3
α-helix	55-65	11
β-strand	73-74	2	13
α-helix	76-78	3
α-helix	87-94	8
α-helix	99-106	8
α-helix	112-124	13
β-strand	127-128	2	13
α-helix	130-139	10
α-helix	142-158	17

Chain C: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	7-15	9
α-helix	19-26	8
α-helix	31-36	6
α-helix	38-44	7
α-helix	45-47	3
α-helix	52-54	3
α-helix	55-65	11
β-strand	73-74	2	14
α-helix	76-78	3
α-helix	87-94	8
α-helix	99-106	8
α-helix	112-124	13
β-strand	127-128	2	14
α-helix	130-139	10
α-helix	142-159	18

Chain D: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	0-8	9	15
α-helix	12-14	3
α-helix	16-24	9
β-strand	37-43	7	15
β-strand	50-56	7	15
α-helix	59-60	2
β-strand	66-75	10	15
β-strand	83-90	8	16
β-strand	93-97	5	17
β-strand	103	1	18
β-strand	109	1	18
α-helix	110	1
β-strand	111-115	5	17
α-helix	119-130	12
α-helix	131-133	3
β-strand	134-143	10	16
β-strand	147-149	3	19
β-strand	156-158	3	19
β-strand	161-169	9	16
α-helix	172-181	10
α-helix	187-189	3
β-strand	194-198	5	16

Chain E: 20 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	4-16	13	20
β-strand	20	1	21
β-strand	26	1	21
β-strand	28-31	4	22
β-strand	34-37	4	22
β-strand	38-39	2	20
α-helix	41-49	9
α-helix	52-57	6
β-strand	63-67	5	23
α-helix	68-79	12
α-helix	85-96	12
β-strand	107-114	8	23
α-helix	116-131	16
α-helix	136-143	8
α-helix	148-151	4
α-helix	152-156	5
α-helix	158-163	6
β-strand	165	1	24
α-helix	172-175	4
β-strand	178	1	24
β-strand	182-184	3	20
α-helix	185-186	2
β-strand	187-189	3	20
β-strand	196-200	5	25
α-helix	213-214	2
β-strand	215-219	5	25
β-strand	220-231	12	20
α-helix	232-238	7
α-helix	244-260	17
α-helix	267-270	4
α-helix	274-275	2
β-strand	276-284	9	20
α-helix	291-294	4
α-helix	297-300	4
α-helix	305-322	18
β-strand	329-333	5	20
β-strand	345-347	3	20
α-helix	350-358	9

Chain F: 20 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	4-16	13	26
β-strand	20	1	27
β-strand	26	1	27
β-strand	28-31	4	28
β-strand	34-37	4	28
β-strand	38-39	2	26
α-helix	41-50	10
α-helix	52-57	6
α-helix	60-62	3
β-strand	63-67	5	29
α-helix	68-79	12
α-helix	85-96	12
β-strand	107-114	8	29
α-helix	116-131	16
α-helix	136-143	8
α-helix	148-151	4
α-helix	152-156	5
α-helix	158-163	6
β-strand	165	1	30
α-helix	172-175	4
β-strand	178	1	30
β-strand	182-184	3	26
α-helix	185-186	2
β-strand	187-189	3	26
β-strand	196-200	5	31
β-strand	215-219	5	31
β-strand	220-231	12	26
α-helix	232-238	7
α-helix	244-260	17
α-helix	267-270	4
α-helix	274-276	3
β-strand	278-284	7	26
α-helix	291-294	4
α-helix	298-300	3
α-helix	305-323	19
β-strand	329-333	5	26
β-strand	345-347	3	26
α-helix	350-358	9

Chain G: 19 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	4-16	13	32
β-strand	20	1	33
β-strand	26	1	33
β-strand	28-31	4	34
β-strand	34-37	4	34
β-strand	38-39	2	32
α-helix	41-49	9
α-helix	52-57	6
β-strand	63-67	5	35
α-helix	68-79	12
α-helix	85-96	12
β-strand	107-114	8	35
α-helix	116-131	16
α-helix	136-143	8
α-helix	148-151	4
α-helix	152-156	5
α-helix	158-163	6
β-strand	165	1	36
α-helix	172-175	4
β-strand	178	1	36
β-strand	182-184	3	32
α-helix	185-186	2
β-strand	187-189	3	32
α-helix	194-195	2
β-strand	196-200	5	37
β-strand	215-219	5	37
β-strand	220-231	12	32
α-helix	232-238	7
α-helix	244-260	17
α-helix	267-270	4
β-strand	278-284	7	32
α-helix	291-294	4
α-helix	297-300	4
α-helix	305-323	19
β-strand	329-333	5	32
β-strand	345-347	3	32
α-helix	350-358	9

Chain H: 19 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	4-16	13	38
β-strand	20	1	39
β-strand	26	1	39
β-strand	28-31	4	40
β-strand	34-37	4	40
β-strand	38-39	2	38
α-helix	41-49	9
α-helix	52-57	6
β-strand	63-67	5	41
α-helix	68-79	12
α-helix	85-96	12
β-strand	107-114	8	41
α-helix	116-131	16
α-helix	136-145	10
α-helix	148-151	4
α-helix	152-156	5
α-helix	158-163	6
β-strand	165	1	42
α-helix	172-175	4
β-strand	178	1	42
β-strand	182-184	3	38
β-strand	187-189	3	38
α-helix	194-195	2
β-strand	196-200	5	43
β-strand	215-219	5	43
β-strand	220-231	12	38
α-helix	232-238	7
α-helix	244-260	17
α-helix	267-270	4
β-strand	278-284	7	38
α-helix	291-294	4
α-helix	297-300	4
α-helix	305-323	19
β-strand	329-333	5	38
α-helix	339-341	3
β-strand	345-347	3	38
α-helix	350-358	9

14 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CRISPR system Cascade subunit CasA	A, M	protein	502	Escherichia coli K12	Q46901 (AlphaFold model)
CRISPR system Cascade subunit CasB	B, C, N, O	protein	160	Escherichia coli K12	P76632 (AlphaFold model)
CRISPR system Cascade subunit CasE	D, P	protein	201	Escherichia coli K12	Q46897 (AlphaFold model)
CRISPR system Cascade subunit CasC	E, F, G, H, I, J, Q, R, S, T, U, V	protein	363	Escherichia coli K12	Q46899 (AlphaFold model)
CRISPR system Cascade subunit CasD	K, W	protein	224	Escherichia coli K12	Q46898
crRNA	L, X	RNA	61	Escherichia coli str. K-12 substr. MG1655

Sequence of entity 1 (A, M), FASTA

>4U7U_1 CRISPR system Cascade subunit CasA (chains A, M)
MNLLIDNWIPVRPRNGGKVQIINLQSLYCSRDQWRLSLPRDDMELAALALLVCIGQIIAP
AKDDVEFRHRIMNPLTEDEFQQLIAPWIDMFYLNHAEHPFMQTKGVKANDVTPMEKLLAG
VSGATNCAFVNQPGQGEALCGGCTAIALFNQANQAPGFGGGFKSGLRGGTPVTTFVRGID
LRSTVLLNVLTLPRLQKQFPNESHTENQPTWIKPIKSNESIPASSIGFVRGLFWQPAHIE
LCDPIGIGKCSCCGQESNLRYTGFLKEKFTFTVNGLWPHPHSPCLVTVKKGEVEEKFLAF
TTSAPSWTQISRVVVDKIIQNENGNRVAAVVNQFRNIAPQSPLELIMGGYRNNQASILER
RHDVLMFNQGWQQYGNVINEIVTVGLGYKTALRKALYTFAEGFKNKDFKGAGVSVHETAE
RHFYRQSELLIPDVLANVNFSQADEVIADLRDKLHQLCEMLFNQSVAPYAHHPKLISTLA
LARATLYKHLRELKPQGGPSNG

Sequence of entity 2 (B, C, N, O), FASTA

>4U7U_2 CRISPR system Cascade subunit CasB (chains B, C, N, O)
MADEIDAMALYRAWQQLDNGSCAQIRRVSEPDELRDIPAFYRLVQPFGWENPRHQQALLR
MVFCLSAGKNVIRHQDKKSEQTTGISLGRALANSGRINERRIFQLIRADRTADMVQLRRL
LTHAEPVLDWPLMARMLTWWGKRERQQLLEDFVLTTNKNA

Sequence of entity 3 (D, P), FASTA

>4U7U_3 CRISPR system Cascade subunit CasE (chains D, P)
AWMYLSKVIIARAWSRDLYQLHQGLWHLFPNRPDAARDFLFHVEKRNTPEGCHVLLQSAQ
MPVSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQKRLDSKGNIKRCRVPLIK
EAEQIAWLQRKLGNAARVEDVHPISERPQYFSGDGKSGKIQTVCFEGVLTINDAPALIDL
VQQGIGPAKSMGCGLLSLAPL

Sequence of entity 4 (E, F, G, H, I, J, Q, R, S, T, U, V), FASTA

>4U7U_4 CRISPR system Cascade subunit CasC (chains E, F, G, H, I, J, Q, R, S, T, U, V)
MSNFINIHVLISHSPSCLNRDDMNMQKDAIFGGKRRVRISSQSLKRAMRKSGYYAQNIGE
SSLRTIHLAQLRDVLRQKLGERFDQKIIDKTLALLSGKSVDEAEKISADAVTPWVVGEIA
WFCEQVAKAEADNLDDKKLLKVLKEDIAAIRVNLQQGVDIALSGRMATSGMMTELGKVDG
AMSIAHAITTHQVDSDIDWFTAVDDLQEQGSAHLGTQEFSSGVFYRYANINLAQLQENLG
GASREQALEIATHVVHMLATEVPGAKQRTYAAFNPADMVMVNFSDMPLSMANAFEKAVKA
KDGFLQPSIQAFNQYWDRVANGYGLNGAAAQFSLSDVDPITAQVKQMPTLEQLKSWVRNN
GEA

Sequence of entity 5 (K, W), FASTA

>4U7U_5 CRISPR system Cascade subunit CasD (chains K, W)
MRSYLILRLAGPMQAWGQPTFEGTRPTGRFPTRSGLLGLLGACLGIQRDDTSSLQALSES
VQFAVRCDELILDDRRVSVTGLRDYHTVLGAREDYRGLKSHETIQTWREYLCDASFTVAL
WLTPHATMVISELEKAVLKPRYTPYLGRRSCPLTHPLFLGTCQASDPQKALLNYEPVGGD
IYSEESVTGHHLKFTARDEPMITLPRQFASREWYVIKGGMDVSQ

Sequence of entity 6 (L, X), FASTA

>4U7U_6 crRNA (chains L, X)
AUAAACCGGGCUCCCUGUCGGUUGUAAUUGAUAAUGUUGAGAGUUCCCCGCGCCAGCGGG
G

Primary citation

Crystal structure of the RNA-guided immune surveillance Cascade complex in Escherichia coli. Zhao, H., Sheng, G., Wang, J. et al. Nature (2014) 515:147-150. DOI 10.1038/nature13733 · PubMed

Other PDB entries of the same protein (UniProt Q46901 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5H9F 2.45 Å, Crystal structure of E. coli Cascade bound to a PAM-containing dsDNA target at 2.45…
4QYZ 3.03 Å, Crystal structure of a CRISPR RNA-guided surveillance complex, Cascade, bound to a ssDNA…
5CD4 3.2 Å, The Type IE CRISPR Cascade complex from E. coli, with two assemblies in the asymmetric…
5H9E 3.21 Å, Crystal structure of E. coli Cascade bound to a PAM-containing dsDNA target (32-nt…
4TVX 3.24 Å, Crystal structure of the E. coli CRISPR RNA-guided surveillance complex, Cascade

Browse structure collections

About this viewer

MolViewer shows 4U7U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.