4UAO: Apical merozoite antigen 1

Crystal structure of Apical Membrane Antigen 1 from Plasmodium Knowlesi in complex with an invasion inhibitory antibody. Determined by X-ray diffraction at 3.1 Å resolution. Released 29 Apr 2015.

Method: X-ray diffraction
Resolution: 3.1 Å
Organisms: Plasmodium knowlesi, Rattus norvegicus
Chains: 3
Atoms: 6,004
Mol. weight: 90.15 kDa
Released: 29 Apr 2015

Explore 4UAO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4UAO contains 28 α-helices and 70 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	58-62	5
α-helix	64-67	4
β-strand	74	1	1
β-strand	78	1	2
β-strand	81	1	3
β-strand	86	1	3
β-strand	89	1	2
β-strand	96-97	2	4
β-strand	99-104	6	5
β-strand	113	1	6
α-helix	114	1
α-helix	121-123	3
β-strand	127	1	6
α-helix	128-129	2
β-strand	138-139	2	4
α-helix	140-146	7
α-helix	151-154	4
α-helix	158-167	10
α-helix	172-174	3
β-strand	183-186	4	4
β-strand	191-194	4	4
β-strand	195	1	6
β-strand	220-225	6	5
β-strand	232-235	4	4
α-helix	243-246	4
β-strand	251-252	2	7
β-strand	256-258	3	8
β-strand	260-261	2	9
β-strand	264-265	2	9
β-strand	272-275	4	7
α-helix	279-289	11
β-strand	292	1	1
α-helix	305-313	9
α-helix	317-321	5
β-strand	344-348	5	7
α-helix	349-351	3
β-strand	353-357	5	7
β-strand	363-365	3	8
β-strand	370-374	5	7
β-strand	382-383	2	7

Chain B: 7 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	10
β-strand	7	1	11
β-strand	10-13	4	12
β-strand	19-24	6	11
β-strand	25	1	10
β-strand	33	1	13
β-strand	35-38	4	12
β-strand	45-49	5	12
β-strand	53-54	2	12
α-helix	55	1
β-strand	62-67	6	11
β-strand	70-75	6	11
β-strand	84-87	4	12
β-strand	89-90	2	13
α-helix	96	1
β-strand	97-98	2	13
β-strand	102-106	5	12
α-helix	107	1
β-strand	111	1	14
β-strand	116-118	3	15
α-helix	119-121	3
α-helix	124-127	4
β-strand	129-139	11	15
β-strand	140	1	14
β-strand	144-150	7	16
β-strand	153-154	2	16
β-strand	159-160	2	15
α-helix	163-165	3
β-strand	173-182	10	15
α-helix	183-187	5
β-strand	191-198	8	16
β-strand	205-210	6	16

Chain C: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	17
β-strand	10-12	3	18
β-strand	18-25	8	17
α-helix	29-31	3
β-strand	34-39	6	18
β-strand	45-51	7	18
β-strand	57-58	2	18
β-strand	67-72	6	17
α-helix	73-75	3
β-strand	77-82	6	17
α-helix	84-86	3
β-strand	88-94	7	18
β-strand	103	1	18
β-strand	107-111	5	18
α-helix	117-119	3
β-strand	120-122	3	19
β-strand	135-145	11	19
β-strand	151-154	4	20
α-helix	155-157	3
β-strand	163-165	3	19
α-helix	166-168	3
β-strand	169-171	3	19
β-strand	174-184	11	19
α-helix	185-190	6
β-strand	194-198	5	20
β-strand	206-209	4	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apical merozoite antigen 1	A	protein	370	Plasmodium knowlesi	A0A384KGX8 (AlphaFold model)
immunoglobulin R31C2 light chain	B	protein	214	Rattus norvegicus	P01835 (AlphaFold model)
immunoglobulin R31C2 VH and CH1 regions	C	protein	223	Rattus norvegicus	P20760 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4UAO_1 Apical merozoite antigen 1 (chains A)
EFPIIERSIRMSNPWKAFMEKYDLERAHNSGIRIDLGEDAEVGNSKYRIPAGKCPVFGKG
IVIENSKVSFLTPVATGAQRLKEGGFAFPNADDHISPITIANLKERYKENADLMKLNDIA
LCKTHAASFVIAEDQNTNYRHPAVYDEKEKTCYMLYLSAQENMGPRYCSPDSQNKDAMFC
FKPDKNEKFDNLVYLSKNVRNDWENKCPRKNLGNAKFGLWVDGNCEEIPYVNEVEARSLR
ECNRIVFEASASDQPRQYEEELTDYEKIQEGFRQNNRDMIKSAFLPVGAFNSDNFKSKGR
GYNWANFDSVNNKCYIFNTKPTCLINDKNFFATTALSHPQEVDNEFPGLEQKLISEEDLN
SAVDHHHHHH

Sequence of entity 2 (B), FASTA

>4UAO_2 immunoglobulin R31C2 light chain (chains B)
DIQMTQSPSSMSASLGDRVTITCQASQDIGNNLIWFQQKPGKSPRRMIYYATKLANGVPS
RFSGSRSGSDYSLTIISLESEDMADYHCLQYKQFPLTFGSGTRLEIKRADAAPTVSIFPP
STEQLATGGASVVCLMNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLS
LTKADYESHNLYTCEVVHKTSSSPVVKSFNRNEC

Sequence of entity 3 (C), FASTA

>4UAO_3 immunoglobulin R31C2 VH and CH1 regions (chains C)
EVQLVESGGGLVQPGRSLKLSCAASGFTFSNYYMAWVRQAPKKGLEWVATITTSGSRSYY
PDSVKGRFTISRDNSESSLYLQMNSLESEDTATYYCARRGYGGYSEDFDYWGQGVMVTVS
SAETTAPSVYPLAPGTALKSNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQS
GLYTLTSSVTVPSSTWSSQAVTCNVAHPASSTKVDKKIVPREC

Primary citation

Crystal Structure of Plasmodium knowlesi Apical Membrane Antigen 1 and Its Complex with an Invasion-Inhibitory Monoclonal Antibody. Vulliez-Le Normand, B., Faber, B.W., Saul, F.A. et al. PLoS One (2015) 10:e0123567-e0123567. DOI 10.1371/journal.pone.0123567 · PubMed

Other PDB entries of the same protein (UniProt A0A384KGX8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UV6 2.45 Å, Crystal structure of apical membrane antigen 1 from Plasmodium knowlesi

Browse structure collections

About this viewer

MolViewer shows 4UAO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.