4UV6: Apical merozoite antigen 1

Crystal structure of apical membrane antigen 1 from Plasmodium knowlesi. Determined by X-ray diffraction at 2.45 Å resolution. Released 29 Apr 2015.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: PLASMODIUM KNOWLESI
Chains: 2
Atoms: 5,809
Mol. weight: 85.02 kDa
Released: 29 Apr 2015

Explore 4UV6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4UV6 contains 28 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	58-62	5
α-helix	64-67	4
β-strand	74	1	1
β-strand	78-82	5	2
β-strand	85-89	5	2
β-strand	96-97	2	3
β-strand	99-103	5	4
β-strand	113	1	5
α-helix	114-115	2
α-helix	121-123	3
β-strand	127	1	5
β-strand	138-139	2	3
α-helix	140-146	7
α-helix	151-154	4
α-helix	158-166	9
β-strand	183-186	4	3
β-strand	191-194	4	3
β-strand	195	1	5
β-strand	202	1	4
β-strand	221-225	5	4
α-helix	227-229	3
β-strand	232-235	4	3
α-helix	243-246	4
β-strand	251-258	8	6
β-strand	259-261	3	7
β-strand	264-266	3	7
α-helix	267-268	2
β-strand	272-275	4	6
α-helix	279-289	11
β-strand	292	1	1
α-helix	305-313	9
α-helix	317-322	6
α-helix	333-335	3
β-strand	344-348	5	6
β-strand	353-357	5	6
β-strand	363-374	12	6
β-strand	382-383	2	6
β-strand	393-395	3	8

Chain B: 14 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	58-62	5
α-helix	64-67	4
β-strand	74	1	9
β-strand	78-82	5	10
β-strand	85-89	5	10
β-strand	96-97	2	11
β-strand	99-103	5	12
β-strand	113	1	13
α-helix	114-115	2
α-helix	121-123	3
β-strand	127	1	13
α-helix	128-130	3
β-strand	138-139	2	11
α-helix	140-146	7
α-helix	151-154	4
α-helix	158-166	9
β-strand	169-171	3	8
β-strand	183-186	4	11
β-strand	191-194	4	11
β-strand	195	1	13
β-strand	202	1	12
β-strand	221-225	5	12
α-helix	227-229	3
β-strand	232-235	4	11
α-helix	243-246	4
β-strand	251-258	8	14
β-strand	259-261	3	15
β-strand	264-266	3	15
α-helix	267-268	2
β-strand	272-275	4	14
α-helix	279-289	11
β-strand	292	1	9
α-helix	305-313	9
α-helix	317-321	5
β-strand	344-348	5	14
β-strand	353-357	5	14
β-strand	363-374	12	14
β-strand	382-383	2	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apical merozoite antigen 1	A, B	protein	370	PLASMODIUM KNOWLESI	A0A384KGX8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4UV6_1 APICAL MEROZOITE ANTIGEN 1 (chains A, B)
EFPIIERSIRMSNPWKAFMEKYDLERAHNSGIRIDLGEDAEVGNSKYRIPAGKCPVFGKG
IVIENSKVSFLTPVATGAQRLKEGGFAFPNADDHISPITIANLKERYKENADLMKLNDIA
LCKTHAASFVIAEDQNTNYRHPAVYDEKEKTCYMLYLSAQENMGPRYCSPDSQNKDAMFC
FKPDKNEKFDNLVYLSKNVRNDWENKCPRKNLGNAKFGLWVDGNCEEIPYVNEVEARSLR
ECNRIVFEASASDQPRQYEEELTDYEKIQEGFRQNNRDMIKSAFLPVGAFNSDNFKSKGR
GYNWANFDSVNNKCYIFNTKPTCLINDKNFFATTALSHPQEVDNEFPGLEQKLISEEDLN
SAVDHHHHHH

Primary citation

Crystal Structure of Plasmodium Knowlesi Apical Membrane Antigen 1 and its Complex with an Invasion-Inhibitory Monoclonal Antibody. Vulliez-Le Normand, B., Faber, B.W., Saul, F.A. et al. PLoS One (2015) 10:23567. DOI 10.1371/JOURNAL.PONE.0123567 · PubMed

Other PDB entries of the same protein (UniProt A0A384KGX8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UAO 3.1 Å, Crystal structure of Apical Membrane Antigen 1 from Plasmodium Knowlesi in complex with…

Browse structure collections

About this viewer

MolViewer shows 4UV6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.