4UED: Eukaryotic translation initiation factor 4E

Name: PDB 4UED: Complex of human eIF4E with the 4E binding protein 4E-BP1
Published: 2015-02-25
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: translation

Complex of human eIF4E with the 4E binding protein 4E-BP1. Determined by X-ray diffraction at 1.75 Å resolution. Released 25 Feb 2015.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,878
Mol. weight: 25.99 kDa
Released: 25 Feb 2015

Explore 4UED in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4UED contains 13 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	38-49	12	1
α-helix	56-59	4
β-strand	60-68	9	1
α-helix	69-76	8
α-helix	82-84	3
α-helix	86	1
β-strand	89-95	7	1
β-strand	111-117	7	1
α-helix	119-121	3
α-helix	122-126	5
α-helix	127-138	12
α-helix	143-148	6
β-strand	149-156	8	1
β-strand	161-167	7	1
α-helix	173-187	15
β-strand	196-199	4	1
α-helix	200-203	4
β-strand	215-216	2	1

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	56-62	7
α-helix	66-69	4
α-helix	71-72	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 4E	A	protein	186	HOMO SAPIENS	P06730 (AlphaFold model)
Eukaryotic translation factor 4E-binding protein 1	B	protein	38	HOMO SAPIENS	Q13541 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4UED_1 EUKARYOTIC TRANSLATION INITIATION FACTOR 4E (chains A)
GPHMKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDY
SLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCG
AVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTT
KNRFVV

Sequence of entity 2 (B), FASTA

>4UED_2 EUKARYOTIC TRANSLATION FACTOR 4E-BINDING PROTEIN 1 (chains B)
GPHMTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTS

Primary citation

Molecular Architecture of 4E-BP Translational Inhibitors Bound to Eif4E. Peter, D., Igreja, C., Weber, R. et al. Mol Cell (2015) 57:1074. DOI 10.1016/J.MOLCEL.2015.01.017 · PubMed

Other PDB entries of the same protein (UniProt P06730 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4TPW 1.5 Å, The co-complex structure of the translation initiation factor eIF4E with the inhibitor…
5T46 1.53 Å, Crystal structure of the human eIF4E-eIF4G complex
8QM8 1.58 Å, Potential drug binding sites for translation initiation factor eIF4E
4TQB 1.59 Å, The co-complex structure of the translation initiation factor eIF4E with the inhibitor…
5ZJY 1.59 Å, Stapled-peptides tailored against initiation of translation
7D6Y 1.67 Å, eIF4E in Complex with a Disulphide-Free Autonomous VH Domain
5ZJZ 1.67 Å, Stapled-peptides tailored against initiation of translation
5EI3 1.71 Å, Co-crystal structure of eIF4E with nucleotide mimetic inhibitor.
5ZK9 1.76 Å, Stapled-peptides tailored against initiation of translation
4TQC 1.8 Å, The co-complex structure of the translation initiation factor eIF4E with the inhibitor…
5ZML 1.8 Å, Stapled-peptides tailored against initiation of translation
7XTP 1.83 Å, eIF4E in Complex with a Disulphide-Free Autonomous VH Domain

Browse structure collections

About this viewer

MolViewer shows 4UED directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.