Crystal Structure of the Extracellular Domain of the Human Alpha9 Nicotinic Acetylcholine Receptor In Complex with Methyllycaconitine. Determined by X-ray diffraction at 1.71 Å resolution. Released 1 Oct 2014.
Explore 4UXU in 3D Show helices and sheets RCSB PDB PDBe
4UXU contains 11 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-14 | 10 | |
| β-strand | 31-46 | 16 | 1 |
| β-strand | 51-68 | 18 | 1 |
| α-helix | 71-73 | 3 | |
| β-strand | 79-83 | 5 | 1 |
| α-helix | 84-86 | 3 | |
| β-strand | 92-94 | 3 | 2 |
| β-strand | 97 | 1 | 1 |
| α-helix | 103-107 | 5 | |
| β-strand | 109-113 | 5 | 1 |
| β-strand | 115-129 | 15 | 1 |
| β-strand | 131-133 | 3 | 2 |
| β-strand | 141-150 | 10 | 2 |
| β-strand | 158-162 | 5 | 1 |
| β-strand | 166 | 1 | 3 |
| β-strand | 168 | 1 | 1 |
| α-helix | 172-175 | 4 | |
| β-strand | 178-182 | 5 | 2 |
| β-strand | 184 | 1 | 3 |
| β-strand | 185-192 | 8 | 2 |
| α-helix | 196-198 | 3 | |
| β-strand | 199-210 | 12 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-14 | 10 | |
| β-strand | 31-46 | 16 | 4 |
| β-strand | 51-68 | 18 | 4 |
| α-helix | 71-74 | 4 | |
| β-strand | 79-83 | 5 | 4 |
| α-helix | 84-86 | 3 | |
| β-strand | 92-94 | 3 | 2 |
| β-strand | 97 | 1 | 4 |
| β-strand | 109-113 | 5 | 4 |
| β-strand | 115-129 | 15 | 4 |
| β-strand | 131-133 | 3 | 2 |
| β-strand | 141-150 | 10 | 2 |
| β-strand | 158-162 | 5 | 4 |
| β-strand | 166 | 1 | 5 |
| β-strand | 168 | 1 | 4 |
| α-helix | 172-175 | 4 | |
| β-strand | 178-182 | 5 | 2 |
| β-strand | 184 | 1 | 5 |
| β-strand | 185-192 | 8 | 2 |
| α-helix | 196-198 | 3 | |
| β-strand | 199-210 | 12 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Neuronal acetylcholine receptor subunit alpha-9 | A, B | protein | 218 | HOMO SAPIENS | Q9UGM1 (AlphaFold model) |
>4UXU_1 NEURONAL ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-9 (chains A, B) ADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQ IWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITW DAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEV HGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| MLK | Methyllycaconitine | C37 H50 N2 O10 | 2 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 4 |
Water and common crystallization additives (EPE, EDO, NA) are not listed.
Crystal Structures of Free and Antagonist-Bound States of Human Alpha9 Nicotinic Receptor Extracellular Domain. Zouridakis, M., Giastas, P., Zarkadas, E. et al. Nat Struct Mol Biol (2014) 21:976. DOI 10.1038/NSMB.2900 · PubMed
Other PDB entries of the same protein (UniProt Q9UGM1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4UXU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.