4UY2: Neuronal acetylcholine receptor subunit alpha-9

Crystal structure of the complex of the extracellular domain of human alpha9 nAChR with alpha-bungarotoxin. Determined by X-ray diffraction at 2.7 Å resolution. Released 1 Oct 2014.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: HOMO SAPIENS, BUNGARUS MULTICINCTUS
Chains: 4
Atoms: 4,468
Mol. weight: 67.57 kDa
Ligands: NAG
Released: 1 Oct 2014

Explore 4UY2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4UY2 contains 7 α-helices and 46 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	31-46	16	1
β-strand	51-63	13	1
α-helix	72-74	3
β-strand	79-83	5	1
α-helix	84-86	3
β-strand	92-94	3	2
β-strand	97	1	1
β-strand	108	1	3
β-strand	109-113	5	1
β-strand	117-120	4	1
β-strand	123-129	7	1
β-strand	130-132	3	2
β-strand	142-150	9	2
β-strand	158-162	5	1
β-strand	166	1	4
β-strand	168	1	1
β-strand	182	1	2
β-strand	184	1	4
β-strand	187-190	4	2
β-strand	199-208	10	2

Chain B: 2 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	31-46	16	5
β-strand	51-63	13	5
α-helix	71-73	3
β-strand	79-83	5	5
α-helix	84-86	3
β-strand	92-94	3	6
β-strand	97	1	5
β-strand	108	1	3
β-strand	109-113	5	5
β-strand	117-120	4	5
β-strand	123-129	7	5
β-strand	130-133	4	6
β-strand	141-150	10	6
β-strand	158-162	5	5
β-strand	166	1	7
β-strand	168	1	5
β-strand	182	1	6
β-strand	184	1	7
β-strand	185-190	6	6
β-strand	199-207	9	6

Chains C and D: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	8
β-strand	12-15	4	8
α-helix	16-17	2
β-strand	22-28	7	9
β-strand	39-45	7	9
β-strand	58-60	3	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neuronal acetylcholine receptor subunit alpha-9	A, B	protein	218	HOMO SAPIENS	Q9UGM1 (AlphaFold model)
Alpha-bungarotoxin isoform V31	C, D	protein	74	BUNGARUS MULTICINCTUS	P60616 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4UY2_1 NEURONAL ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-9 (chains A, B)
ADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQ
IWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITW
DAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEV
HGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSHHHHHH

Sequence of entity 2 (C, D), FASTA

>4UY2_2 ALPHA-BUNGAROTOXIN ISOFORM V31 (chains C, D)
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCC
STDKCNPHPKQRPG

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Primary citation

Crystal Structures of Free and Antagonist-Bound States of Human Alpha9 Nicotinic Receptor Extracellular Domain. Zouridakis, M., Giastas, P., Zarkadas, E. et al. Nat Struct Mol Biol (2014) 21:976. DOI 10.1038/NSMB.2900 · PubMed

Other PDB entries of the same protein (UniProt Q9UGM1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UXU 1.71 Å, Crystal Structure of the Extracellular Domain of the Human Alpha9 Nicotinic…
4D01 1.79 Å, Crystal Structure of the Extracellular Domain of the Human Alpha9 Nicotinic…
6HY7 2.26 Å, Crystal structure of alpha9 nAChR extracellular domain in complex with alpha-conotoxin…

Browse structure collections

About this viewer

MolViewer shows 4UY2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.