4WF0: ILID - an Improved Light-Inducible Dimer

Crystal Structure of iLID - an Improved Light-Inducible Dimer. Determined by X-ray diffraction at 1.95 Å resolution. Released 24 Dec 2014.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Avena sativa
Chains: 2
Atoms: 2,711
Mol. weight: 37.52 kDa
Ligands: FMN
Released: 24 Dec 2014

Explore 4WF0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WF0 contains 12 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	408-410	3
β-strand	414-418	5	1
β-strand	427-430	4	1
α-helix	432-438	7
α-helix	442-445	4
α-helix	450-453	4
α-helix	460-472	13
β-strand	476-483	8	1
β-strand	489-500	12	1
β-strand	506-516	11	1
α-helix	522-545	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NPH1-1	A, B	protein	158	Avena sativa	O49003 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4WF0_1 NPH1-1 (chains A, B)
MRGSHHHHHHGSLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCR
FLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNVFHLQPMRDYKGDVQYFIG
VQLDGTERLHGAAEREAVCLIKKTAFQIAEAANDENYF

Ligands and cofactors

ID	Name	Formula	Copies
FMN	Flavin mononucleotide	C17 H21 N4 O9 P	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Engineering an improved light-induced dimer (iLID) for controlling the localization and activity of signaling proteins. Guntas, G., Hallett, R.A., Zimmerman, S.P. et al. Proc Natl Acad Sci U S A (2015) 112:112-117. DOI 10.1073/pnas.1417910112 · PubMed

Other PDB entries of the same protein (UniProt O49003 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PGZ 0.9 Å, Structure of dark-adapted AsLOV2 Q513L
7PH0 0.98 Å, Structure of light-adapted AsLOV2 Q513L
7PGX 1.0 Å, Structure of dark-adapted AsLOV2 wild type
7PGY 1.09 Å, Structure of light-adapted AsLOV2 wild type
2V0U 1.4 Å, n- and c-terminal helices of oat lov2 (404-546) are involved in light-induced signal…
2V1B 1.55 Å, N- and C-terminal helices of oat LOV2 (404-546) are involved in light-induced signal…
2WKQ 1.6 Å, Structure of a photoactivatable Rac1 containing the Lov2 C450A Mutant
2V1A 1.65 Å, N- and C-terminal helices of oat LOV2 (404-546) are involved in light-induced signal…
2V0W 1.7 Å, N- and C-terminal helices of oat LOV2 (404-546) are involved in light- induced signal…
6NTP 1.89 Å, PTP1B Domain of PTP1B-LOV2 Chimera
2WKP 1.9 Å, Structure of a photoactivatable Rac1 containing Lov2 Wildtype
5EFW 2.1 Å, Crystal structure of LOV2-Zdk1 - the complex of oat LOV2 and the affibody protein Zdark1

Browse structure collections

About this viewer

MolViewer shows 4WF0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.