4WFQ: TFIIH subunit

Crystal structure of TFIIH subunit. Determined by X-ray diffraction at 2.4 Å resolution. Released 18 Feb 2015.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,564
Mol. weight: 21.6 kDa
Released: 18 Feb 2015

Explore 4WFQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WFQ contains 8 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	125-131	7	1
α-helix	134-137	4
α-helix	145-163	19
β-strand	168-175	8	1
β-strand	178-186	9	1
α-helix	189-199	11
α-helix	210-221	12
β-strand	231-236	6	1
α-helix	247-256	10
β-strand	260-266	7	1
α-helix	271-279	9
β-strand	288-291	4	1
α-helix	294-305	12
α-helix	307-309	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Suppressor of stem-loop protein 1	A	protein	192	Saccharomyces cerevisiae	Q04673 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4WFQ_1 Suppressor of stem-loop protein 1 (chains A)
QRGIIRSLILTLDCSEAMLEKDLRPNRHAMIIQYAIDFVHEFFDQNPISQMGIIIMRNGL
AQLVSQVSGNPQDHIDALKSIRKQEPKGNPSLQNALEMARGLLLPVPAHCTREVLIVFGS
LSTTDPGDIHQTIDSLVSEKIRVKVLGLSAQVAICKELCKATNYGDESFYKILLDETHLK
ELFNEAVTPLPV

Primary citation

Crystal structure of the Rad3/XPD regulatory domain of Ssl1/p44. Kim, J.S., Saint-Andre, C., Lim, H.S. et al. J Biol Chem (2015) 290:8321-8330. DOI 10.1074/jbc.M115.636514 · PubMed

Other PDB entries of the same protein (UniProt Q04673 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7O4J 2.9 Å, Yeast RNA polymerase II transcription pre-initiation complex (consensus)
7ML0 3.0 Å, RNA polymerase II pre-initiation complex (PIC1)
8CEN 3.0 Å, Yeast RNA polymerase II transcription pre-initiation complex with core Mediator
7ML4 3.1 Å, RNA polymerase II initially transcribing complex (ITC)
7ZS9 3.1 Å, Yeast RNA polymerase II transcription pre-initiation complex with the +1 nucleosome…
7O4I 3.2 Å, Yeast RNA polymerase II transcription pre-initiation complex with initial transcription…
7O75 3.2 Å, Yeast RNA polymerase II transcription pre-initiation complex with open promoter DNA
7ML2 3.4 Å, RNA polymerase II pre-initiation complex (PIC3)
7O4L 3.4 Å, Yeast TFIIH in the expanded state within the pre-initiation complex
7O72 3.4 Å, Yeast RNA polymerase II transcription pre-initiation complex with closed promoter DNA
7O73 3.4 Å, Yeast RNA polymerase II transcription pre-initiation complex with closed distorted…
7O4K 3.6 Å, Yeast TFIIH in the contracted state within the pre-initiation complex

Browse structure collections

About this viewer

MolViewer shows 4WFQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.