4WIP: DIX domain of human Dvl2

DIX domain of human Dvl2. Determined by X-ray diffraction at 2.69 Å resolution. Released 13 May 2015.

Method: X-ray diffraction
Resolution: 2.69 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,994
Mol. weight: 33.63 kDa
Released: 13 May 2015

Explore 4WIP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WIP contains 6 α-helices and 24 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	14-20	7	1
β-strand	27-31	5	1
β-strand	39	1	2
α-helix	40-47	8
β-strand	54-61	8	1
β-strand	65-71	7	1
β-strand	77	1	2
α-helix	78-79	2
β-strand	81	1	1
β-strand	84-90	7	1

Chain B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	14-20	7	1
β-strand	27-31	5	1
β-strand	39	1	3
α-helix	40-47	8
β-strand	54-61	8	1
β-strand	65-70	6	1
β-strand	77	1	3
α-helix	78-79	2
β-strand	81	1	1
β-strand	84-90	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Segment polarity protein dishevelled homolog DVL-2	A, B, C	protein	97	Homo sapiens	O14641 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>4WIP_1 Segment polarity protein dishevelled homolog DVL-2 (chains A, B, C)
MGETKVIYHLDEEETPDLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEE
ISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPVHEPR

Primary citation

Ubiquitination of the Dishevelled DIX domain blocks its head-to-tail polymerization. Madrzak, J., Fiedler, M., Johnson, C.M. et al. Nat Commun (2015) 6:6718-6718. DOI 10.1038/ncomms7718 · PubMed

Other PDB entries of the same protein (UniProt O14641 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CBZ 1.38 Å, The Dvl2 PDZ Domain in Complex with the N2 Inhibitory Peptide
3CBY 1.5 Å, The Dvl2 PDZ Domain in Complex with the N1 Inhibitory Peptide
2REY 1.55 Å, Crystal structure of the PDZ domain of human dishevelled 2 (homologous to Drosophila dsh)
6IW3 1.64 Å, High resolution structure of Dvl2-DIX Y27W/C80S mutant
3CBX 1.7 Å, The Dvl2 PDZ Domain in Complex with the C1 Inhibitory Peptide
3CC0 1.75 Å, The Dvl2 PDZ Domain in Complex with the N3 Inhibitory Peptide
8WWR 1.75 Å, Crystal structure of apo human dishevelled 2 (Dvl2) PDZ domain
5SUZ 1.84 Å, Domain-swapped dimer of human Dishevelled2 DEP domain: C-centered monoclinic crystal…
5SUY 1.88 Å, Domain-swapped dimer of human Dishevelled2 DEP domain: monoclinic crystal form…
35UG 1.95 Å, Human DVL2 PDZ domain in complex with Vangl2
5LNP 1.99 Å, Domain-swapped dimer of human Dishevelled2 DEP domain: monoclinic crystal form…
8YR7 3.0 Å, Crystal structure of human dishevelled 2 (Dvl2) PDZ domain fused with WGEF internal…

Browse structure collections

About this viewer

MolViewer shows 4WIP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.