Crystal Structure of SUMO1 in complex with PML. Determined by X-ray diffraction at 1.46 Å resolution. Released 31 Dec 2014.
Explore 4WJO in 3D Show helices and sheets RCSB PDB PDBe
4WJO contains 5 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 19-21 | 3 | |
| β-strand | 22-27 | 6 | 1 |
| β-strand | 33-38 | 6 | 1 |
| α-helix | 45-55 | 11 | |
| α-helix | 59-61 | 3 | |
| β-strand | 62-66 | 5 | 1 |
| β-strand | 69-70 | 2 | 1 |
| α-helix | 71-72 | 2 | |
| α-helix | 77-80 | 4 | |
| β-strand | 87-92 | 6 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-13 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Small ubiquitin-related modifier 1 | A | protein | 83 | Homo sapiens | P63165 (AlphaFold model) |
| Protein PML | B | protein | 29 | Homo sapiens | P29590 (AlphaFold model) |
>4WJO_1 Small ubiquitin-related modifier 1 (chains A) GSKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADN HTPKELGMEEEDVIEVYQEQTGG
>4WJO_2 Protein PML (chains B) GSGAGEAEERVVVISSSEDSDAENSSSRY
Structural and Functional Characterization of the Phosphorylation-Dependent Interaction between PML and SUMO1. Cappadocia, L., Mascle, X.H., Bourdeau, V. et al. Structure (2015) 23:126-138. DOI 10.1016/j.str.2014.10.015 · PubMed
Other PDB entries of the same protein (UniProt P63165 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4WJO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.