4WK8: FOXP3 forms a domain-swapped dimer to bridge DNA

FOXP3 forms a domain-swapped dimer to bridge DNA. Determined by X-ray diffraction at 3.4 Å resolution. Released 21 Jan 2015.

Method: X-ray diffraction
Resolution: 3.4 Å
Organisms: synthetic construct, Homo sapiens
Chains: 4
Atoms: 2,243
Mol. weight: 33.05 kDa
Released: 21 Jan 2015

Explore 4WK8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WK8 contains 9 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain F: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	342-351	10
β-strand	358	1	1
α-helix	360-371	12
α-helix	382-391	10
β-strand	395-398	4	2
β-strand	405-408	4	2
α-helix	410-415	6

Chain G: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	338-341	4
α-helix	342-352	11
β-strand	357-358	2	2
α-helix	360-376	17
α-helix	381-391	11
β-strand	395-399	5	1
β-strand	404-408	5	1
α-helix	410-412	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(tptpapgpgpapapapaptptptpgptptptpcpaptpap*g)-3')	A	DNA	21	synthetic construct
DNA (5'-d(apapcptpaptpgpapapapcpapapaptptptptpcpcp*t)-3')	B	DNA	21	synthetic construct
Forkhead box protein P3	F, G	protein	82	Homo sapiens	Q9BZS1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4WK8_1 DNA (5'-D(*TP*TP*AP*GP*GP*AP*AP*AP*AP*TP*TP*TP*GP*TP*TP*TP*CP*AP*TP*AP*G)-3') (chains A)
TTAGGAAAATTTGTTTCATAG

Sequence of entity 2 (B), FASTA

>4WK8_2 DNA (5'-D(*AP*AP*CP*TP*AP*TP*GP*AP*AP*AP*CP*AP*AP*AP*TP*TP*TP*TP*CP*CP*T)-3') (chains B)
AACTATGAAACAAATTTTCCT

Sequence of entity 3 (F, G), FASTA

>4WK8_3 Forkhead box protein P3 (chains F, G)
MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCF
VRVESEKGAVWTVDELEFRKKR

Primary citation

DNA binding by FOXP3 domain-swapped dimer suggests mechanisms of long-range chromosomal interactions. Chen, Y., Chen, C., Zhang, Z. et al. Nucleic Acids Res (2015) 43:1268-1282. DOI 10.1093/nar/gku1373 · PubMed

Other PDB entries of the same protein (UniProt Q9BZS1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3QRF 2.8 Å, Structure of a domain-swapped FOXP3 dimer

Browse structure collections

About this viewer

MolViewer shows 4WK8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.