3QRF: Domain-swapped FOXP3 dimer

Structure of a domain-swapped FOXP3 dimer. Determined by X-ray diffraction at 2.8 Å resolution. Released 20 Apr 2011.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 10
Atoms: 9,105
Mol. weight: 130.61 kDa
Ligands: MG
Released: 20 Apr 2011

Explore 3QRF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QRF contains 32 α-helices and 68 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains F and H: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	338-340	3
α-helix	342-351	10
β-strand	358	1	10
α-helix	360-371	12
α-helix	381-391	11
β-strand	395-398	4	11
β-strand	405-408	4	11
α-helix	410-416	7

Chains G and I: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	337-341	5
α-helix	342-351	10
β-strand	357-358	2	11
α-helix	360-376	17
α-helix	381-391	11
β-strand	395-398	4	10
β-strand	405-408	4	10

Chains M and N: 7 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	394-396	3
β-strand	404-405	2	12
β-strand	408-409	2	12
β-strand	411-414	4	13
α-helix	415-417	3
β-strand	419	1	14
α-helix	422	1
β-strand	423-424	2	15
β-strand	442-444	3	13
β-strand	454-461	8	16
β-strand	470	1	16
β-strand	474-478	5	15
β-strand	489-493	5	16
β-strand	496-503	8	16
α-helix	505-507	3
β-strand	510-512	3	13
β-strand	516-520	5	15
α-helix	523-527	5
β-strand	541-542	2	14
β-strand	543-549	7	16
β-strand	559-561	3	16
α-helix	564-566	3
β-strand	567-568	2	14
α-helix	571-576	6
β-strand	582	1	17
β-strand	587-589	3	18
β-strand	595-599	5	17
β-strand	609-614	6	19
β-strand	620-625	6	19
β-strand	637-641	5	17
β-strand	655-656	2	18
β-strand	657-660	4	19
β-strand	661	1	20
β-strand	667	1	20
β-strand	673-676	4	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear factor of activated T-cells, cytoplasmic 2	M, N	protein	286	Homo sapiens	Q13469 (AlphaFold model)
Forkhead box protein P3	F, G, H, I	protein	82	Homo sapiens	Q9BZS1 (AlphaFold model)
human hARRE2 DNA (Plus Strand)	A, C	DNA	21
human hARRE2 DNA (Minus Strand)	B, D	DNA	21

Sequence of entity 1 (M, N), FASTA

>3QRF_1 Nuclear factor of activated T-cells, cytoplasmic 2 (chains M, N)
SSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENK
PLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRAT
IDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQR
SAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVAAAA
AAPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV

Sequence of entity 2 (F, G, H, I), FASTA

>3QRF_2 Forkhead box protein P3 (chains F, G, H, I)
MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCF
VRVESEKGAVWTVDELEFRKKR

Sequence of entity 3 (A, C), FASTA

>3QRF_3 human hARRE2 DNA (Plus Strand) (chains A, C)
TTAGGAAAATTTGTTTCATAG

Sequence of entity 4 (B, D), FASTA

>3QRF_4 human hARRE2 DNA (Minus Strand) (chains B, D)
AACTATGAAACAAATTTTCCT

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4

Primary citation

Structure of a Domain-Swapped FOXP3 Dimer on DNA and Its Function in Regulatory T Cells. Bandukwala, H.S., Wu, Y., Feuerer, M. et al. Immunity (2011) 34:479-491. DOI 10.1016/j.immuni.2011.02.017 · PubMed

Other PDB entries of the same protein (UniProt Q13469 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8R3F 1.55 Å, C-terminal Rel-homology Domain of NFAT1
8R07 1.74 Å, C-terminal Rel-homology Domain of NFAT1
1P7H 2.6 Å, Structure of NFAT1 bound as a dimer to the HIV-1 LTR kB element
9VRT 2.64 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2-P DNA
9VS2 2.65 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE3-P DNA
1A02 2.7 Å, Structure of the DNA binding domains of nfat, fos and jun bound to DNA
2AS5 2.7 Å, Structure of the DNA binding domains of NFAT and FOXP2 bound specifically to DNA.
8OW4 2.75 Å, 2.75 angstrom crystal structure of human NFAT1 with bound DNA
9VRQ 2.8 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2 DNA
1OWR 3.0 Å, Crystal structure of human NFAT1 bound monomerically to DNA
2O93 3.05 Å, Crystal structure of NFAT bound to the HIV-1 LTR tandem kappaB enhancer element
1PZU 3.1 Å, An asymmetric NFAT1-RHR homodimer on a pseudo-palindromic, Kappa-B site

Browse structure collections

About this viewer

MolViewer shows 3QRF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.