4WR5: GST Mutated with Halogenated Tyrosine

Crystal Structure of GST Mutated with Halogenated Tyrosine (7cGST-1). Determined by X-ray diffraction at 1.93 Å resolution. Released 19 Aug 2015.

Method: X-ray diffraction
Resolution: 1.93 Å
Organism: Schistosoma japonicum
Chains: 1
Atoms: 1,934
Mol. weight: 28.88 kDa
Ligands: GSH
Released: 19 Aug 2015

Explore 4WR5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WR5 contains 11 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	0-2	3
β-strand	3-7	5	1
α-helix	11-13	3
α-helix	14-22	9
β-strand	28-32	5	1
α-helix	37-41	5
α-helix	44-46	3
β-strand	56-58	3	1
β-strand	63-65	3	1
α-helix	67-77	11
α-helix	85-109	25
α-helix	114-135	22
β-strand	141	1	2
β-strand	144	1	2
α-helix	149-164	16
α-helix	173-183	11
α-helix	186-193	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutathione S-transferase class-mu 26 kDa isozyme	A	protein	244	Schistosoma japonicum	P08515 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4WR5_1 Glutathione S-transferase class-mu 26 kDa isozyme (chains A)
MASMTGGQQMGRDPGANSGVTKNSXSPILGYWKIKGLVQPTRLLLEXLEEKYEEHLXERD
EGDKWRNKKFELGLEFPNLPYXIDGDVKLTQSMAIIRXIADKHNMLGGCPKERAEISMLE
GAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTXLNGDHVTHPDFMLY
DALDVVLXMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHP
PKSD

Ligands and cofactors

ID	Name	Formula	Copies
GSH	Glutathione	C10 H17 N3 O6 S	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Protein stabilization utilizing a redefined codon. Ohtake, K., Yamaguchi, A., Mukai, T. et al. Sci Rep (2015) 5:9762-9762. DOI 10.1038/srep09762 · PubMed

Other PDB entries of the same protein (UniProt P08515 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8OK1 1.38 Å, WD repeat containing protein 5 (WDR5)- N225A mutant
6JI6 1.5 Å, Crystal structure of glutathione S-transferase complexed and modified with glutathione
6RWD 1.53 Å, Crystal structure of SjGST in complex with GSH and ellagic acid at 1.53 Angstrom…
4WR4 1.6 Å, Crystal Structure of GST Mutated with Halogenated Tyrosine (7bGST-1)
9NME 1.6 Å, SARS-CoV-2 3CLPro in complex with 2-[2-hydroxy-3-(4-isoquinolyl)-4-oxo-6-(trifluoromethyl…
8GYD 1.7 Å, Structure of Schistosoma japonicum Glutathione S-transferase bound with the ligand…
9N4U 1.77 Å, Crystal structure of PAK1 bound to compound R1
1DUG 1.8 Å, Structure of the fibrinogen G chain integrin binding and factor xiiia crosslinking sites…
9NMF 1.8 Å, SARS-CoV-2 3CLPro in complex with 8-(6-amino-3-pyridyl)-2-hydroxy-3-(4-isoquinolyl)-6-(tr…
7AL7 1.8 Å, The Crystal Structure of Human IL-18 in Complex With Human IL-18 Binding Protein
8OKF 1.85 Å, WD repeat containing protein 5 (WDR5)- PER2 peptide
9N48 1.85 Å, Crystal structure of PAK1 bound to compound C1

Browse structure collections

About this viewer

MolViewer shows 4WR5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.