Crystal Structure of Adaptor Protein 2 Associated Kinase (AAK1) in complex with small molecule inhibitor. Determined by X-ray diffraction at 1.95 Å resolution. Released 5 Nov 2014.
Explore 4WSQ in 3D Show helices and sheets RCSB PDB PDBe
4WSQ contains 33 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 30-34 | 5 | |
| β-strand | 38-41 | 4 | 1 |
| β-strand | 44-53 | 10 | 1 |
| β-strand | 59-65 | 7 | 1 |
| β-strand | 70-78 | 9 | 1 |
| α-helix | 81-97 | 17 | |
| β-strand | 103 | 1 | 2 |
| α-helix | 104-105 | 2 | |
| β-strand | 106-113 | 8 | 1 |
| β-strand | 120-127 | 8 | 1 |
| β-strand | 133 | 1 | 2 |
| α-helix | 134-139 | 6 | |
| α-helix | 148-166 | 19 | |
| β-strand | 173 | 1 | 3 |
| α-helix | 179-181 | 3 | |
| β-strand | 182-186 | 5 | 2 |
| β-strand | 189-192 | 4 | 2 |
| β-strand | 199 | 1 | 3 |
| α-helix | 205-208 | 4 | |
| α-helix | 210-220 | 11 | |
| α-helix | 223-225 | 3 | |
| α-helix | 228-231 | 4 | |
| α-helix | 242-257 | 16 | |
| α-helix | 266-271 | 6 | |
| β-strand | 276 | 1 | 4 |
| α-helix | 284-293 | 10 | |
| α-helix | 304-314 | 11 | |
| α-helix | 327-330 | 4 | |
| α-helix | 333-337 | 5 | |
| β-strand | 338 | 1 | 4 |
| α-helix | 339-344 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 38-39 | 2 | 5 |
| α-helix | 42-44 | 3 | |
| β-strand | 46-53 | 8 | 5 |
| β-strand | 59-64 | 6 | 5 |
| β-strand | 70-78 | 9 | 5 |
| α-helix | 81-97 | 17 | |
| β-strand | 103 | 1 | 6 |
| α-helix | 104-105 | 2 | |
| β-strand | 106-113 | 8 | 5 |
| β-strand | 120-126 | 7 | 5 |
| β-strand | 133 | 1 | 6 |
| α-helix | 134-139 | 6 | |
| α-helix | 148-166 | 19 | |
| β-strand | 173 | 1 | 7 |
| α-helix | 179-181 | 3 | |
| β-strand | 182-186 | 5 | 6 |
| β-strand | 189-192 | 4 | 6 |
| β-strand | 199 | 1 | 7 |
| α-helix | 205-208 | 4 | |
| α-helix | 210-220 | 11 | |
| α-helix | 223-225 | 3 | |
| α-helix | 228-231 | 4 | |
| α-helix | 242-257 | 16 | |
| α-helix | 266-271 | 6 | |
| β-strand | 276 | 1 | 8 |
| α-helix | 284-293 | 10 | |
| α-helix | 304-314 | 11 | |
| α-helix | 327-330 | 4 | |
| α-helix | 333-337 | 5 | |
| β-strand | 338 | 1 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| AP2-associated protein kinase 1 | A, B | protein | 317 | Homo sapiens | Q2M2I8 (AlphaFold model) |
>4WSQ_1 AP2-associated protein kinase 1 (chains A, B) GLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCK REIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQTGFTE NEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTE GVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVA ICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSP IPAKLPEPVKASEAAAK
Water and common crystallization additives (EDO) are not listed.
Family-wide Structural Analysis of Human Numb-Associated Protein Kinases. Sorrell, F.J., Szklarz, M., Abdul Azeez, K.R. et al. Structure (2016) 24:401-411. DOI 10.1016/j.str.2015.12.015 · PubMed
Other PDB entries of the same protein (UniProt Q2M2I8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4WSQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.