Structure of FGFR1 in complex with AZD4547 (N-{3-[2-(3,5-DIMETHOXYPHENYL)ETHYL]-1H-PYRAZOL-5-YL}-4-[(3R,5S)-3,5-DIMETHYLPIPERAZIN-1-YL]BENZAMIDE) at 1.65 angstrom. Determined by X-ray diffraction at 1.65 Å resolution. Released 19 Nov 2014.
Explore 4WUN in 3D Show helices and sheets RCSB PDB PDBe
4WUN contains 33 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 472 | 1 | 1 |
| α-helix | 475-477 | 3 | |
| β-strand | 478-483 | 6 | 1 |
| β-strand | 488 | 1 | 2 |
| β-strand | 490 | 1 | 2 |
| β-strand | 491-498 | 8 | 1 |
| β-strand | 508-515 | 8 | 1 |
| α-helix | 522-538 | 17 | |
| β-strand | 544 | 1 | 3 |
| β-strand | 547-551 | 5 | 1 |
| β-strand | 558-562 | 5 | 1 |
| β-strand | 568 | 1 | 3 |
| α-helix | 569-574 | 6 | |
| α-helix | 593-596 | 4 | |
| α-helix | 597-616 | 20 | |
| α-helix | 626-628 | 3 | |
| β-strand | 629-631 | 3 | 3 |
| β-strand | 637-639 | 3 | 3 |
| α-helix | 664-666 | 3 | |
| α-helix | 669-674 | 6 | |
| α-helix | 679-694 | 16 | |
| α-helix | 698-699 | 2 | |
| α-helix | 706-714 | 9 | |
| α-helix | 719-722 | 4 | |
| α-helix | 727-736 | 10 | |
| α-helix | 741-743 | 3 | |
| α-helix | 745-746 | 2 | |
| α-helix | 747-760 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 465-467 | 3 | |
| β-strand | 472 | 1 | 4 |
| α-helix | 475-477 | 3 | |
| β-strand | 478-483 | 6 | 4 |
| α-helix | 484 | 1 | |
| β-strand | 488 | 1 | 5 |
| β-strand | 490 | 1 | 5 |
| β-strand | 491-498 | 8 | 4 |
| β-strand | 508-515 | 8 | 4 |
| α-helix | 522-538 | 17 | |
| β-strand | 544 | 1 | 6 |
| β-strand | 547-551 | 5 | 4 |
| β-strand | 558-562 | 5 | 4 |
| β-strand | 568 | 1 | 6 |
| α-helix | 569-574 | 6 | |
| α-helix | 597-616 | 20 | |
| α-helix | 626-628 | 3 | |
| β-strand | 629-631 | 3 | 6 |
| β-strand | 637-639 | 3 | 6 |
| α-helix | 663-666 | 4 | |
| α-helix | 669-674 | 6 | |
| α-helix | 679-694 | 16 | |
| α-helix | 698-699 | 2 | |
| α-helix | 706-714 | 9 | |
| α-helix | 719-722 | 4 | |
| α-helix | 727-736 | 10 | |
| α-helix | 741-743 | 3 | |
| α-helix | 745-746 | 2 | |
| α-helix | 747-760 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fibroblast growth factor receptor 1 | A, B | protein | 311 | Homo sapiens | P11362 (AlphaFold model) |
>4WUN_1 Fibroblast growth factor receptor 1 (chains A, B) GAMSGVSEYELPEDPRWELPRDRLVLGKPLGEGAFGQVVLAEAIGLDKDKPNRVTKVAVK MLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQ ARRPPGLEYSYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTED NVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIF TLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDL DRIVALTSNQE
| ID | Name | Formula | Copies |
|---|---|---|---|
| 66T | N-{3-[2-(3,5-dimethoxyphenyl)ethyl]-1H-pyrazol-5-yl}-4-[(3R,5S)-3,5-dimethylpip… | C26 H33 N5 O3 | 2 |
The 1.65 angstrom resolution structure of the complex of AZD4547 with the kinase domain of FGFR1 displays exquisite molecular recognition. Yosaatmadja, Y., Patterson, A.V., Smaill, J.B. et al. Acta Crystallogr D Biol Crystallogr (2015) 71:525-533. DOI 10.1107/S1399004714027539 · PubMed
Other PDB entries of the same protein (UniProt P11362 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4WUN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.