5EW8: Fibroblast growth factor receptor 1

Fibroblast growth factor receptor 1 in complex with jnj-4275693. Determined by X-ray diffraction at 1.63 Å resolution. Released 30 Mar 2016.

Method: X-ray diffraction
Resolution: 1.63 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,145
Mol. weight: 71.45 kDa
Ligands: 5SF
Released: 30 Mar 2016

Explore 5EW8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EW8 contains 37 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	465-467	3
β-strand	472	1	1
α-helix	475-477	3
β-strand	478-486	9	1
β-strand	490-498	9	1
β-strand	508-516	9	1
α-helix	522-538	17
β-strand	544	1	2
β-strand	547-551	5	1
β-strand	558-562	5	1
β-strand	568	1	2
α-helix	569-574	6
α-helix	578-579	2
α-helix	593-596	4
α-helix	597-616	20
α-helix	626-628	3
β-strand	629-631	3	2
β-strand	637-639	3	2
α-helix	648-650	3
α-helix	655-657	3
α-helix	663-666	4
α-helix	669-674	6
α-helix	679-694	16
α-helix	698-699	2
α-helix	706-714	9
α-helix	719-722	4
α-helix	727-736	10
α-helix	741-743	3
α-helix	745-746	2
α-helix	747-760	14

Chain B: 17 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	465-467	3
β-strand	472	1	3
α-helix	475-477	3
β-strand	478-486	9	3
β-strand	490-498	9	3
β-strand	501	1	4
β-strand	504	1	4
β-strand	508-516	9	3
α-helix	522-538	17
β-strand	544	1	5
β-strand	547-551	5	3
β-strand	558-562	5	3
β-strand	568	1	5
α-helix	569-574	6
α-helix	594-596	3
α-helix	597-616	20
α-helix	626-628	3
β-strand	629-631	3	5
β-strand	637-639	3	5
α-helix	663-666	4
α-helix	669-674	6
α-helix	679-694	16
α-helix	698-699	2
α-helix	706-714	9
α-helix	719-722	4
α-helix	727-736	10
α-helix	741-743	3
α-helix	745-746	2
α-helix	747-760	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibroblast growth factor receptor 1	A, B	protein	309	Homo sapiens	P11362 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5EW8_1 Fibroblast growth factor receptor 1 (chains A, B)
GAGVSEYELPEDPRWELPRDRLVLGKPLGEGAFGQVVLAEAIGLDKDKPNRVTKVAVKML
KSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQAR
RPPGLEYSYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNV
MKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTL
GGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDR
IVALTSNQE

Ligands and cofactors

ID	Name	Formula	Copies
5SF	~{N}'-(3,5-dimethoxyphenyl)-~{N}'-[3-(1-methylpyrazol-4-yl)quinoxalin-6-yl]-~{N…	C25 H30 N6 O2	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

Landscape of activating cancer mutations in FGFR kinases and their differential responses to inhibitors in clinical use. Patani, H., Bunney, T.D., Thiyagarajan, N. et al. Oncotarget (2016) 7:24252-24268. DOI 10.18632/oncotarget.8132 · PubMed

Other PDB entries of the same protein (UniProt P11362 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4WUN 1.65 Å, Structure of FGFR1 in complex with AZD4547 (N-{3-[2-(3,5-DIMETHOXYPHENYL)ETHYL]-1H-PYRAZO…
9U7G 1.66 Å, FGFR1 kinase domain with a macrocyclic compound 8g
7OZB 1.71 Å, FGFR1 kinase domain (residues 458-765) with mutations C488A, C584S in complex with 38.
8XZ7 1.75 Å, FGFR1 kinase domain with a covalent inhibitor 10h
9UHI 1.76 Å, FGFR1 kinase domain with a covalent inhibitor 9o
9VLJ 1.81 Å, Crystal structure of FGFR1 in complex with covalent inhibitor 10a
7OZD 1.82 Å, FGFR1 kinase domain (residues 458-765) with mutations C488A, C584S in complex with 34.
7OZF 1.82 Å, FGFR1 kinase domain (residues 458-765) with mutations C488A, C584S in complex with 19.
9UHC 1.88 Å, FGFR1 kinase domain with a covalent inhibitor 9p
9WFK 1.89 Å, Crystal structure of FGFR1 kinase domain in complex with…
9WGT 1.9 Å, Crystal structure of FGFR1 kinase domain in complex with…
5O49 1.91 Å, Human FGF in complex with a covalent inhibitor

Browse structure collections

About this viewer

MolViewer shows 5EW8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.