Structural basis for mutation-induced destabilization of Profilin 1 in ALS. Determined by X-ray diffraction at 2.16 Å resolution. Released 10 Jun 2015.
Explore 4X1L in 3D Show helices and sheets RCSB PDB PDBe
4X1L contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-11 | 7 | |
| β-strand | 17-24 | 8 | 1 |
| β-strand | 30-34 | 5 | 1 |
| α-helix | 40-42 | 3 | |
| α-helix | 45-51 | 7 | |
| β-strand | 64-66 | 3 | 1 |
| β-strand | 69-77 | 9 | 1 |
| β-strand | 85-90 | 6 | 1 |
| β-strand | 100-105 | 6 | 1 |
| β-strand | 109-115 | 7 | 1 |
| α-helix | 121-136 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Profilin-1 | A | protein | 140 | Homo sapiens | P07737 (AlphaFold model) |
>4X1L_1 Profilin-1 (chains A) MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVH GGLINKKCYEMASHLRRSQY
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 1 |
Structural basis for mutation-induced destabilization of profilin 1 in ALS. Boopathy, S., Silvas, T.V., Tischbein, M. et al. Proc Natl Acad Sci U S A (2015) 112:7984-7989. DOI 10.1073/pnas.1424108112 · PubMed
Other PDB entries of the same protein (UniProt P07737 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4X1L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.