4X3H: Arc N-lobe

Crystal structure of arc N-lobe complexed with stargazin peptide. Determined by X-ray diffraction at 2.4 Å resolution. Released 3 Jun 2015.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Rattus norvegicus, Mus musculus
Chains: 2
Atoms: 806
Mol. weight: 10.62 kDa
Released: 3 Jun 2015

Explore 4X3H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4X3H contains 6 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	211-214	4	1
α-helix	217-228	12
α-helix	235-241	7
α-helix	242-245	4
β-strand	246	1	1
α-helix	249-257	9
α-helix	258-260	3
α-helix	264-276	13

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	226-229	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Activity-regulated cytoskeleton-associated protein	A	protein	79	Rattus norvegicus	Q63053 (AlphaFold model)
Voltage-dependent calcium channel gamma-2 subunit	B	protein	9	Mus musculus	O88602 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4X3H_1 Activity-regulated cytoskeleton-associated protein (chains A)
GPLGSPEFPGLDTQIFEDPREFLSHLEEYLRQVGGSEEYWLSQIQNHMNGPAKKWWEFKQ
GSVKNWVEFKKEFLQYSEG

Sequence of entity 2 (B), FASTA

>4X3H_2 VOLTAGE-DEPENDENT CALCIUM CHANNEL GAMMA-2 SUBUNIT (chains B)
RIPSYRYRY

Primary citation

Structural basis of arc binding to synaptic proteins: implications for cognitive disease. Zhang, W., Wu, J., Ward, M.D. et al. Neuron (2015) 86:490-500. DOI 10.1016/j.neuron.2015.03.030 · PubMed

Other PDB entries of the same protein (UniProt Q63053 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4X3I 1.8 Å, The crystal structure of Arc N-lobe complexed with CAMK2A fragment
4X3X 2.0 Å, The crystal structure of Arc C-lobe
7R24 2.7 Å, Crystal structure of rat Arc CTD in complex with two anti-Arc nanobodies
6GSE Solution structure of the capsid domain from the activity-regulated…

Browse structure collections

About this viewer

MolViewer shows 4X3H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.