4X3X: Arc C-lobe

The crystal structure of Arc C-lobe. Determined by X-ray diffraction at 2.0 Å resolution. Released 3 Jun 2015.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 720
Mol. weight: 10.62 kDa
Released: 3 Jun 2015

Explore 4X3X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4X3X contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	279-288	10
α-helix	298-312	15
α-helix	318-327	10
α-helix	331-337	7
α-helix	341-342	2
α-helix	345-359	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Activity-regulated cytoskeleton-associated protein	A	protein	90	Rattus norvegicus	Q63053 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4X3X_1 Activity-regulated cytoskeleton-associated protein (chains A)
GPLGSTLSREAIQRELDLPQKQGEPLDQFLWRKRDLYQTLYVDAEEEEIIQYVVGTLQPK
FKRFLRHPLPKTLEQLIQRGMEVQDGLEQA

Primary citation

Structural basis of arc binding to synaptic proteins: implications for cognitive disease. Zhang, W., Wu, J., Ward, M.D. et al. Neuron (2015) 86:490-500. DOI 10.1016/j.neuron.2015.03.030 · PubMed

Other PDB entries of the same protein (UniProt Q63053 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4X3I 1.8 Å, The crystal structure of Arc N-lobe complexed with CAMK2A fragment
4X3H 2.4 Å, Crystal structure of arc N-lobe complexed with stargazin peptide
7R24 2.7 Å, Crystal structure of rat Arc CTD in complex with two anti-Arc nanobodies
6GSE Solution structure of the capsid domain from the activity-regulated…

Browse structure collections

About this viewer

MolViewer shows 4X3X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.