Crystal structure of Ash2L SPRY domain in complex with phosphorylated RbBP5. Determined by X-ray diffraction at 2.1 Å resolution. Released 28 Jan 2015.
Explore 4X8N in 3D Show helices and sheets RCSB PDB PDBe
4X8N contains 3 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 289-294 | 6 | 1 |
| β-strand | 299-300 | 2 | 2 |
| β-strand | 306-308 | 3 | 2 |
| β-strand | 314-318 | 5 | 1 |
| β-strand | 322 | 1 | 3 |
| β-strand | 325-335 | 11 | 2 |
| β-strand | 341-347 | 7 | 1 |
| β-strand | 363-367 | 5 | 1 |
| β-strand | 373-375 | 3 | 1 |
| β-strand | 378-380 | 3 | 1 |
| β-strand | 391-398 | 8 | 2 |
| β-strand | 446-451 | 6 | 2 |
| β-strand | 454-461 | 8 | 2 |
| α-helix | 463-465 | 3 | |
| β-strand | 468 | 1 | 3 |
| β-strand | 469-475 | 7 | 1 |
| β-strand | 479-483 | 5 | 2 |
| β-strand | 498-499 | 2 | 2 |
| α-helix | 500-503 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 353-355 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Set1/Ash2 histone methyltransferase complex subunit ASH2 | A | protein | 181 | Homo sapiens | Q9UBL3 (AlphaFold model) |
| Retinoblastoma-binding protein 5 | B | protein | 10 | Homo sapiens | Q15291 (AlphaFold model) |
>4X8N_1 Set1/Ash2 histone methyltransferase complex subunit ASH2 (chains A) RVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLG WSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDISGR GSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDM G
>4X8N_2 Retinoblastoma-binding protein 5 (chains B) ERESEFDIED
A phosphorylation switch on RbBP5 regulates histone H3 Lys4 methylation. Zhang, P., Chaturvedi, C.P., Tremblay, V. et al. Genes Dev (2015) 29:123-128. DOI 10.1101/gad.254870.114 · PubMed
Other PDB entries of the same protein (UniProt Q9UBL3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4X8N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.