In vitro Crystal Structure of PAK4 in complex with Inka peptide. Determined by X-ray diffraction at 2.06 Å resolution. Released 2 Dec 2015.
Explore 4XBU in 3D Show helices and sheets RCSB PDB PDBe
4XBU contains 23 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 298-311 | 14 | |
| α-helix | 313 | 1 | |
| α-helix | 317-319 | 3 | |
| β-strand | 321-329 | 9 | 1 |
| β-strand | 333-340 | 8 | 1 |
| β-strand | 346-353 | 8 | 1 |
| α-helix | 360-362 | 3 | |
| α-helix | 363-369 | 7 | |
| β-strand | 378 | 1 | 2 |
| α-helix | 379-380 | 2 | |
| β-strand | 381-387 | 7 | 1 |
| β-strand | 390-396 | 7 | 1 |
| β-strand | 401-402 | 2 | 2 |
| α-helix | 403-409 | 7 | |
| α-helix | 414-433 | 20 | |
| β-strand | 436-437 | 2 | 3 |
| α-helix | 443-445 | 3 | |
| β-strand | 446-448 | 3 | 2 |
| β-strand | 454-456 | 3 | 2 |
| β-strand | 463-464 | 2 | 3 |
| β-strand | 472 | 1 | 4 |
| β-strand | 476-477 | 2 | 5 |
| α-helix | 479-481 | 3 | |
| α-helix | 484-487 | 4 | |
| β-strand | 492 | 1 | 4 |
| α-helix | 495-510 | 16 | |
| α-helix | 520-529 | 10 | |
| α-helix | 532-533 | 2 | |
| α-helix | 538-540 | 3 | |
| α-helix | 543-552 | 10 | |
| α-helix | 561-562 | 2 | |
| α-helix | 563-566 | 4 | |
| α-helix | 570-574 | 5 | |
| α-helix | 575-577 | 3 | |
| α-helix | 578-581 | 4 | |
| α-helix | 582-584 | 3 | |
| α-helix | 586-588 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 184-185 | 2 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein kinase PAK 4 | A | protein | 326 | Homo sapiens | O96013 (AlphaFold model) |
| Protein FAM212A | B | protein | 24 | Homo sapiens | Q96EL1 (AlphaFold model) |
>4XBU_1 Serine/threonine-protein kinase PAK 4 (chains A) MAEEHHHHHHHHLEVLFQGPPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFI KIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSY LVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDS ILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMV IEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAE LLKHPFLAKAGPPASIVPLMRQNRTR
>4XBU_2 Protein FAM212A (chains B) AEDWTAALLNRGRSRQPLVLGDNC
An in cellulo-derived structure of PAK4 in complex with its inhibitor Inka1. Baskaran, Y., Ang, K.C., Anekal, P.V. et al. Nat Commun (2015) 6:8681-8681. DOI 10.1038/ncomms9681 · PubMed
Other PDB entries of the same protein (UniProt O96013 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4XBU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.