4XEF: Pyk2-FAT
Pyk2-FAT complexed with Leupaxin LD motif LD1. Determined by X-ray diffraction at 2.5 Å resolution. Released 23 Dec 2015.
- Method
- X-ray diffraction
- Resolution
- 2.5 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 2,442
- Mol. weight
- 39.81 kDa
- Released
- 23 Dec 2015
Explore 4XEF in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4XEF contains 14 α-helices and 0 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 5 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 872-874 | 3 | |
| α-helix | 879-897 | 19 | |
| α-helix | 905-927 | 23 | |
| α-helix | 935-962 | 28 | |
| α-helix | 969-1002 | 34 | |
Chain B: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-14 | 13 | |
Chain C: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-10 | 9 | |
Chain D: 5 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 879-898 | 20 | |
| α-helix | 905-927 | 23 | |
| α-helix | 928-930 | 3 | |
| α-helix | 933-962 | 30 | |
| α-helix | 969-1002 | 34 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-13 | 12 | |
Chain F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-11 | 9 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Protein-tyrosine kinase 2-beta | A, D | protein | 139 | Homo sapiens | Q14289 (AlphaFold model) |
| 20-mer peptide containing LD1 motif of leupaxin | B, C, E, F | protein | 20 | Homo sapiens | O60711 (AlphaFold model) |
Sequence of entity 1 (A, D), FASTA
>4XEF_1 Protein-tyrosine kinase 2-beta (chains A, D)
GSHMANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDD
LLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVD
AKNLLDAVDQAKVLANLAH
Sequence of entity 2 (B, C, E, F), FASTA
>4XEF_2 20-mer peptide containing LD1 motif of leupaxin (chains B, C, E, F)
MEELDALLEELERSTLQDSD
Primary citation
Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats. Vanarotti, M.S., Finkelstein, D.B., Guibao, C.D. et al. Biochemistry (2016) 55:1332-1345. DOI 10.1021/acs.biochem.5b01274 · PubMed
Other PDB entries of the same protein (UniProt Q14289 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3CC6 1.6 Å, Crystal structure of kinase domain of protein tyrosine kinase 2 beta (PTK2B)
- 3FZS 1.75 Å, Crystal Structure of PYK2 complexed with BIRB796
- 4XEK 1.79 Å, Pyk2-FAT domain in complex with leupaxin LD4 motif
- 8XOX 1.9 Å, The Crystal Structure of FAK2 from Biortus.
- 3FZT 1.95 Å, Crystal structure of PYK2 complexed with PF-4618433
- 5TO8 1.98 Å, Selectivity switch between FAK and Pyk2: Macrocyclization of FAK inhibitors improves…
- 4H1M 1.99 Å, Crystal structure of PYK2 with the indole 10c
- 3H3C 2.0 Å, Crystal structure of PYK2 in complex with Sulfoximine-substituted…
- 4H1J 2.0 Å, Crystal structure of PYK2 with the pyrazole 13a
- 8YGX 2.0 Å, Structure of the PYK2 from Biortus.
- 4XEV 2.01 Å, Fusion of Pyk2-FAT domain with Leupaxin LD1 motif, complexed with Leupaxin LD4 peptide
- 3FZP 2.1 Å, Crystal structure of PYK2 complexed with ATPgS
Browse structure collections
About this viewer
MolViewer shows 4XEF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.