4XEK: Pyk2-FAT domain

Pyk2-FAT domain in complex with leupaxin LD4 motif. Determined by X-ray diffraction at 1.79 Å resolution. Released 30 Dec 2015.

Method: X-ray diffraction
Resolution: 1.79 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,212
Mol. weight: 17.32 kDa
Released: 30 Dec 2015

Explore 4XEK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4XEK contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	872-874	3
α-helix	879-897	19
α-helix	903-905	3
α-helix	906-927	22
α-helix	928-930	3
α-helix	933-962	30
α-helix	969-1004	36

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	88-98	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein-tyrosine kinase 2-beta	A	protein	139	Homo sapiens	Q14289 (AlphaFold model)
19-mer peptide containing Leupaxin LD4 motif	C	protein	19	Homo sapiens	O60711 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4XEK_1 Protein-tyrosine kinase 2-beta (chains A)
GSHMANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDD
LLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVD
AKNLLDAVDQAKVLANLAH

Sequence of entity 2 (C), FASTA

>4XEK_2 19-mer peptide containing Leupaxin LD4 motif (chains C)
KTSAAAQLDELMAHLTEMQ

Primary citation

Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats. Vanarotti, M.S., Finkelstein, D.B., Guibao, C.D. et al. Biochemistry (2016) 55:1332-1345. DOI 10.1021/acs.biochem.5b01274 · PubMed

Other PDB entries of the same protein (UniProt Q14289 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CC6 1.6 Å, Crystal structure of kinase domain of protein tyrosine kinase 2 beta (PTK2B)
3FZS 1.75 Å, Crystal Structure of PYK2 complexed with BIRB796
8XOX 1.9 Å, The Crystal Structure of FAK2 from Biortus.
3FZT 1.95 Å, Crystal structure of PYK2 complexed with PF-4618433
5TO8 1.98 Å, Selectivity switch between FAK and Pyk2: Macrocyclization of FAK inhibitors improves…
4H1M 1.99 Å, Crystal structure of PYK2 with the indole 10c
3H3C 2.0 Å, Crystal structure of PYK2 in complex with Sulfoximine-substituted…
4H1J 2.0 Å, Crystal structure of PYK2 with the pyrazole 13a
8YGX 2.0 Å, Structure of the PYK2 from Biortus.
4XEV 2.01 Å, Fusion of Pyk2-FAT domain with Leupaxin LD1 motif, complexed with Leupaxin LD4 peptide
3FZP 2.1 Å, Crystal structure of PYK2 complexed with ATPgS
5TOB 2.12 Å, Selectivity switch between FAK and Pyk2: Macrocyclization of FAK inhibitors improves…

Browse structure collections

About this viewer

MolViewer shows 4XEK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.