4XEV: PDB entry 4XEV

Fusion of Pyk2-FAT domain with Leupaxin LD1 motif, complexed with Leupaxin LD4 peptide. Determined by X-ray diffraction at 2.01 Å resolution. Released 30 Dec 2015.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,579
Mol. weight: 40.25 kDa
Released: 30 Dec 2015

Explore 4XEV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4XEV contains 16 α-helices and 2 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	873	1	1
α-helix	879-898	20
α-helix	903-905	3
α-helix	906-927	22
α-helix	928-930	3
α-helix	933-962	30
α-helix	969-1000	32
β-strand	1006	1	1
α-helix	2003-2012	10

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	88-101	14

Chain D: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	879-897	19
α-helix	898-900	3
α-helix	904-927	24
α-helix	928-930	3
α-helix	933-962	30
α-helix	969-1000	32
α-helix	2002-2012	11

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	88-102	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fusion protein of Protein-tyrosine kinase 2-beta FAT domain and Leupaxin LD1 motif	A, D	protein	167	Homo sapiens	Q14289 (AlphaFold model)
19-mer peptide containing Leupaxin LD4 motif	C, F	protein	19	Homo sapiens	O60711 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>4XEV_1 Fusion protein of Protein-tyrosine kinase 2-beta FAT domain and Leupaxin LD1 motif (chains A, D)
GSHMANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDD
LLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVD
AKNLLDAVDQAKVLANLAHGGSGGGGGMEELDALLEELERSTLQDSD

Sequence of entity 2 (C, F), FASTA

>4XEV_2 19-mer peptide containing Leupaxin LD4 motif (chains C, F)
KTSAAAQLDELMAHLTEMQ

Primary citation

Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats. Vanarotti, M.S., Finkelstein, D.B., Guibao, C.D. et al. Biochemistry (2016) 55:1332-1345. DOI 10.1021/acs.biochem.5b01274 · PubMed

Other PDB entries of the same protein (UniProt Q14289 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CC6 1.6 Å, Crystal structure of kinase domain of protein tyrosine kinase 2 beta (PTK2B)
3FZS 1.75 Å, Crystal Structure of PYK2 complexed with BIRB796
4XEK 1.79 Å, Pyk2-FAT domain in complex with leupaxin LD4 motif
8XOX 1.9 Å, The Crystal Structure of FAK2 from Biortus.
3FZT 1.95 Å, Crystal structure of PYK2 complexed with PF-4618433
5TO8 1.98 Å, Selectivity switch between FAK and Pyk2: Macrocyclization of FAK inhibitors improves…
4H1M 1.99 Å, Crystal structure of PYK2 with the indole 10c
3H3C 2.0 Å, Crystal structure of PYK2 in complex with Sulfoximine-substituted…
4H1J 2.0 Å, Crystal structure of PYK2 with the pyrazole 13a
8YGX 2.0 Å, Structure of the PYK2 from Biortus.
3FZP 2.1 Å, Crystal structure of PYK2 complexed with ATPgS
5TOB 2.12 Å, Selectivity switch between FAK and Pyk2: Macrocyclization of FAK inhibitors improves…

Browse structure collections

About this viewer

MolViewer shows 4XEV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.