4XI5: GHgL of varicella-zoster virus

gHgL of varicella-zoster virus in complex with human neutralizing antibodies. Determined by X-ray diffraction at 3.9 Å resolution. Released 13 May 2015.

Method: X-ray diffraction
Resolution: 3.9 Å
Organisms: Human herpesvirus 3 strain Oka vaccine, Homo sapiens
Chains: 4
Atoms: 9,724
Mol. weight: 162.74 kDa
Ligands: NAG
Released: 13 May 2015

Explore 4XI5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4XI5 contains 44 α-helices and 75 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	37-43	7	1
β-strand	49-54	6	1
α-helix	62-64	3
β-strand	75-81	7	1
β-strand	90-96	7	1
β-strand	127-128	2	2
α-helix	139-142	4
β-strand	145	1	3
β-strand	149	1	3
α-helix	156-158	3
β-strand	160	1	4
α-helix	162-164	3
α-helix	181-186	6
β-strand	192	1	5
α-helix	201-203	3
β-strand	208-210	3	5
α-helix	212-216	5
β-strand	219-223	5	2
α-helix	226-228	3
β-strand	230	1	6
β-strand	233-244	12	2
β-strand	248-255	8	2
β-strand	258-265	8	2
β-strand	271-277	7	2
β-strand	284	1	6
α-helix	295-296	2
β-strand	298	1	4
β-strand	305-310	6	2
α-helix	313-317	5
α-helix	323-327	5
α-helix	336-352	17
α-helix	361-385	25
β-strand	387-389	3	5
α-helix	390-406	17
α-helix	407-412	6
β-strand	420-425	6	2
α-helix	430-441	12
α-helix	455-467	13
α-helix	475-492	18
α-helix	500-513	14
α-helix	526-539	14
α-helix	542-557	16
α-helix	568-570	3
α-helix	574-576	3
β-strand	580	1	7
α-helix	586-593	8
α-helix	596-598	3
α-helix	600-607	8
α-helix	612-628	17
α-helix	634-640	7
α-helix	642-645	4
α-helix	650-654	5
β-strand	657-662	6	7
β-strand	667-672	6	7
β-strand	679-683	5	7
β-strand	694-699	6	7
β-strand	705-707	3	7
β-strand	711-713	3	8
β-strand	730-734	5	8
β-strand	740-745	6	8
α-helix	749-756	8
β-strand	776-780	5	8
β-strand	786-789	4	8

Chain B: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	35-36	2	1
α-helix	41-46	6
α-helix	48-49	2
α-helix	50-53	4
α-helix	67-70	4
β-strand	73-77	5	1
β-strand	84-89	6	1
β-strand	94-98	5	1
α-helix	100-110	11
α-helix	119-129	11

Chain C: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	9
β-strand	10-11	2	10
β-strand	19-25	7	9
β-strand	33-38	6	10
α-helix	43-44	2
β-strand	45-48	4	10
β-strand	62-65	4	9
β-strand	71-75	5	9
α-helix	80-82	3
β-strand	84-90	7	10
β-strand	102-104	3	10
α-helix	113	1
β-strand	114-118	5	11
α-helix	122-125	4
β-strand	129-139	11	11
β-strand	145-147	3	12
α-helix	151-152	2
β-strand	161-163	3	11
α-helix	164-167	4
β-strand	173-182	10	11
β-strand	192-197	6	12
β-strand	206-209	4	12

Chain D: 1 helix, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	13
β-strand	10-11	2	14
β-strand	18-19	2	15
β-strand	21-25	5	13
β-strand	34-39	6	14
β-strand	45-51	7	14
β-strand	58-60	3	14
β-strand	68-72	5	15
β-strand	79-83	5	15
β-strand	92-99	8	14
β-strand	108-111	4	14
β-strand	115-118	4	14
β-strand	125	1	16
β-strand	129-130	2	17
β-strand	146-153	8	17
β-strand	154	1	16
β-strand	158-162	5	18
β-strand	172-173	2	17
α-helix	174-176	3
β-strand	177-178	2	17
β-strand	184-190	7	17
β-strand	203-208	6	18
β-strand	213-214	2	18
β-strand	217-218	2	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Envelope glycoprotein H	A	protein	833	Human herpesvirus 3 strain Oka vaccine	Q775J3
Envelope glycoprotein L	B	protein	138	Human herpesvirus 3 strain Oka vaccine	Q9J3N1
Fab-94 light chain	C	protein	214	Homo sapiens	P0DOX7 (AlphaFold model)
Fab-94 heavy chain	D	protein	283	Homo sapiens	P01857 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4XI5_1 Envelope glycoprotein H (chains A)
MFALVLAVVILPLWTTANKSYVTPTPATRSIGHMSALLREYSDRNMSLKLEAFYPTGFDE
ELIKSLHWGNDRKHVFLVIVKVNPTTHEGDVGLVIFPKYLLSPYHFKAEHRAPFPAGRFG
FLSHPVTPDVSFFDSSFAPYLTTQHLVAFTTFPPNPLVWHLERAETAATAERPFGVSLLP
ARPTVPKNTILEHKAHFATWDALARHTFFSAEAIITNSTLRIHVPLFGSVWPIRYWATGS
VLLTSDSGRVEVNIGVGFMSSLISLSSGLPIELIVVPHTVKLNAVTSDTTWFQLNPPGPD
PGPSYRVYLLGRGLDMNFSKHATVDICAYPEESLDYRYHLSMAHTEALRMTTKADQHDIN
EESYYHIAARIATSIFALSEMGRTTEYFLLDEIVDVQYQLKFLNYILMRIGAGAHPNTIS
GTSDLIFADPSQLHDELSLLFGQVKPANVDYFISYDEARDQLKTAYALSRGQDHVNALSL
ARRVIMSIYKGLLVKQNLNATERQALFFASMILLNFREGLENSSRVLDGRTTLLLMTSMC
TAAHATQAALNIQEGLAYLNPSKHMFTIPNVYSPCMGSLRTDLTEEIHVMNLLSAIPTRP
GLNEVLHTQLDESEIFDAAFKTMMIFTTWTAKDLHILHTHVPEVFTCQDAAARNGEYVLI
LPAVQGHSYVITRNKPQRGLVYSLADVDVYNPISVVYLSKDTCVSEHGVIETVALPHPDN
LKECLYCGSVFLRYLTTGAIMDIIIIDSKDTERQLAAMGNSTIPPFNPDMHGDDSKAVLL
FPNGTVVTLLGFERRGSENLYFQGSWSHPQFEKGGGSGGGSGGGSWSHPQFEK

Sequence of entity 2 (B), FASTA

>4XI5_2 Envelope glycoprotein L (chains B)
LHLQDDTPLFFGAKPLSDVSLIITEPCVSSVYEAWDYAAPPVSNLSEALSGIVVKTKCPV
PEVILWFKDKQMAYWTNPYVTLKGLTQSVGEEHKSGDIRDALLDALSGVWVDSTPSSTNI
PENGCVWGADRLFQRVCQ

Sequence of entity 3 (C), FASTA

>4XI5_3 Fab-94 light chain (chains C)
DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQANNFPLTFGGGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (D), FASTA

>4XI5_4 Fab-94 heavy chain (chains D)
MEFGLSWVFLVAILEGVHCEVQLVESGGGVVQPGRSLRLSCGASGFTFNTYAMHWVRQAP
GKGVEWVAVVSDGGGNRYYAASVKGRFTISRDNSKNTLFLQLNTLRPEDTAVYYCARSRG
NHYYYGMDVWGRGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
KSCDKGSENLYFQGSWSHPQFEKGGGSGGGSGGGSWSHPQFEK

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

A site of varicella-zoster virus vulnerability identified by structural studies of neutralizing antibodies bound to the glycoprotein complex gHgL. Xing, Y., Oliver, S.L., Nguyen, T. et al. Proc Natl Acad Sci U S A (2015) 112:6056-6061. DOI 10.1073/pnas.1501176112 · PubMed

Other PDB entries of the same protein (UniProt Q775J3), best resolution first:

4XHJ 3.16 Å, gHgL of Varicella-zoster virus in complex with human neutralizing antibodies.

Browse structure collections

About this viewer

MolViewer shows 4XI5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.