4XPG: Dopamine transporter

X-ray structure of Drosophila dopamine transporter with subsiteB mutations (D121G/S426M) bound to beta-CFT or Win35428. Determined by X-ray diffraction at 3.21 Å resolution. Released 6 May 2015.

Method: X-ray diffraction
Resolution: 3.21 Å
Organisms: Drosophila melanogaster, Mus musculus
Chains: 3
Atoms: 7,473
Mol. weight: 113.9 kDa
Ligands: 42L, CLR
Released: 6 May 2015

Explore 4XPG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4XPG contains 50 α-helices and 51 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 39 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	33-44	12
α-helix	48-52	5
α-helix	53-59	7
α-helix	62-65	4
α-helix	66-72	7
α-helix	73-77	5
α-helix	78-91	14
α-helix	95-102	8
α-helix	105-107	3
α-helix	108-120	13
α-helix	125-136	12
β-strand	157-158	2	1
β-strand	209-210	2	1
α-helix	211-214	4
α-helix	215-221	7
α-helix	223-225	3
β-strand	235	1	2
α-helix	237-254	18
α-helix	258-268	11
α-helix	271-285	15
α-helix	289-297	9
α-helix	307-321	15
α-helix	327-332	6
α-helix	341-373	33
α-helix	378-380	3
α-helix	387	1
α-helix	388-392	5
α-helix	393-397	5
α-helix	403-434	32
α-helix	444-459	16
β-strand	464	1	2
α-helix	467-477	11
α-helix	480-492	13
α-helix	493-499	7
α-helix	500-510	11
α-helix	514-516	3
α-helix	517-521	5
α-helix	522-526	5
α-helix	527-540	14
β-strand	546-547	2	3
β-strand	550-551	2	3
α-helix	552-553	2
α-helix	554-568	15
α-helix	570-580	11
α-helix	587-590	4

Chain H: 4 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	10
β-strand	10-12	3	11
β-strand	17-25	9	10
α-helix	29-31	3
β-strand	35-40	6	11
β-strand	44-51	8	11
β-strand	58-60	3	11
β-strand	69-73	5	10
β-strand	78-84	7	10
α-helix	88-90	3
β-strand	92-97	6	11
β-strand	109	1	11
β-strand	113-117	5	11
β-strand	123	1	12
β-strand	126-130	5	13
β-strand	141-151	11	13
β-strand	152	1	12
β-strand	157-160	4	14
β-strand	169-177	9	13
β-strand	180-190	11	13
α-helix	193-196	4
β-strand	200-205	6	14
α-helix	206-208	3
β-strand	210-215	6	14

Chain L: 7 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	4
β-strand	10-13	4	5
β-strand	19-25	7	4
β-strand	29	1	6
α-helix	31-33	3
β-strand	34-39	6	5
β-strand	46-50	5	5
β-strand	54-55	2	5
β-strand	63-68	6	4
β-strand	69	1	6
β-strand	71-76	6	4
α-helix	81-83	3
β-strand	86-91	6	5
α-helix	97	1
β-strand	98-99	2	5
β-strand	100	1	4
β-strand	103-107	5	5
β-strand	112	1	7
β-strand	115-119	5	8
α-helix	120-122	3
α-helix	125-128	4
β-strand	130-140	11	8
β-strand	141	1	7
β-strand	146-151	6	9
β-strand	154-155	2	9
β-strand	160-161	2	8
β-strand	164	1	8
α-helix	165-168	4
β-strand	174-183	10	8
α-helix	184-188	5
β-strand	192-198	7	9
β-strand	206-211	6	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dopamine transporter	A	protein	543	Drosophila melanogaster	Q7K4Y6 (AlphaFold model)
antibody fragment light chain	L	protein	237	Mus musculus
antibody fragment heavy chain	H	protein	241	Mus musculus

Sequence of entity 1 (A), FASTA

>4XPG_1 Dopamine transporter (chains A)
MNSISDERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLAVGGIP
LFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVGFYYNVIIAWSLRFFFASF
TNSLPWTSCNNIWNTPNCRPFESQGFQSAASEYFNRYILELNRSEGIHDLGAIKWDMALC
LLIVYLICYFSLWKGISTSGKVVWFTALFPYAALLILLIRGLTLPGSFLGIQYYLTPNFS
AIYKAEVWADAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFV
IFSVLGYMAHTLGVRIEDVATEGPGLVFVVYPAAIATMPASTFWALIFFMMLATLGLDSS
FGGMEAIITALSDEFPKIKRNRELFVAGLFSLYFVVGLASCTQGGFYFFHLLDRYAAGYS
ILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPPGRYWQVCWRFVAPIFLLFITVYLLIGY
EPLTYADYVYPSWANALGWCIAGSSVVMIPAVAIFKLLSTPGSLRQRFTILTTPWRDQQL
VPR

Sequence of entity 2 (L), FASTA

>4XPG_2 antibody fragment light chain (chains L)
MDFQVQIFSFLLISASVAMSRGENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQ
QKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLT
FGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQN
GVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 3 (H), FASTA

>4XPG_3 antibody fragment heavy chain (chains H)
XMNFGLRLVFLVLILKGVQCEVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQS
PEKRLEWVAEISSGGRYIYYSDTVTGRFTISRDNARNILHLEMSSLRSEDTAMYYCARGE
VRQRGFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTW
NSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
P

Ligands and cofactors

ID	Name	Formula	Copies
42L	methyl (1R,2S,3S,5S)-3-(4-fluorophenyl)-8-methyl-8-azabicyclo[3.2.1]octane-2-ca…	C16 H20 F N O2	1
CLR	Cholesterol	C27 H46 O	2

Water and common crystallization additives (NA, CL) are not listed.

Primary citation

Neurotransmitter and psychostimulant recognition by the dopamine transporter. Wang, K.H., Penmatsa, A., Gouaux, E. Nature (2015) 521:322-327. DOI 10.1038/nature14431 · PubMed

Other PDB entries of the same protein (UniProt Q7K4Y6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7WGT 2.75 Å, X-ray structure of thermostabilized Drosophila dopamine transporter with GABA…
4XP4 2.8 Å, X-ray structure of Drosophila dopamine transporter in complex with cocaine
4XP9 2.8 Å, X-ray structure of Drosophila dopamine transporter bound to psychostimulant D-amphetamine
6M2R 2.8 Å, X-ray structure of a functional Drosophila dopamine transporter in L-norepinephrine…
6M0Z 2.88 Å, X-ray structure of Drosophila dopamine transporter with NET-like mutations…
4XP1 2.89 Å, X-ray structure of Drosophila dopamine transporter bound to neurotransmitter dopamine
4XPH 2.9 Å, X-ray structure of Drosophila dopamine transporter with subsiteB mutations (D121G/S426M)…
7WLW 2.9 Å, X-ray structure of thermostabilized Drosophila dopamine transporter with GABA…
4XPA 2.95 Å, X-ray structure of Drosophila dopamine transporter bound to 3,4dichlorophenethylamine
4M48 2.96 Å, X-ray structure of dopamine transporter elucidates antidepressant mechanism
4XNU 2.98 Å, X-ray structure of Drosophila dopamine transporter in complex with nisoxetine
4XNX 3.0 Å, X-ray structure of Drosophila dopamine transporter in complex with reboxetine

Browse structure collections

About this viewer

MolViewer shows 4XPG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.