4Y5I: 14-3-3 protein sigma

Crystal structure of C-terminal modified Tau peptide-hybrid 126B with 14-3-3sigma. Determined by X-ray diffraction at 1.4 Å resolution. Released 13 Jan 2016.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,684
Mol. weight: 55.05 kDa
Released: 13 Jan 2016

Explore 4Y5I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4Y5I contains 26 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	34-37	4
α-helix	38-69	32
α-helix	80-102	23
α-helix	103-107	5
α-helix	114-134	21
α-helix	138-161	24
α-helix	167-182	16
α-helix	187-204	18
α-helix	205-207	3
α-helix	210-230	21

Chain B: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	34-37	4
α-helix	38-68	31
α-helix	80-102	23
α-helix	103-107	5
α-helix	108-110	3
α-helix	114-134	21
α-helix	138-161	24
α-helix	167-178	12
α-helix	179-183	5
α-helix	187-202	16
α-helix	205-207	3
α-helix	210-229	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein sigma	A, B	protein	236	Homo sapiens	P31947 (AlphaFold model)
Microtubule-associated protein tau	F, G	protein	9	Homo sapiens	P10636 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4Y5I_1 14-3-3 protein sigma (chains A, B)
GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQ
RAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAE
SRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALN
FSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT

Sequence of entity 2 (F, G), FASTA

>4Y5I_2 Microtubule-associated protein tau (chains F, G)
XRTPSLPTX

Primary citation

Stabilizer-Guided Inhibition of Protein-Protein Interactions. Milroy, L.G., Bartel, M., Henen, M.A. et al. Angew Chem Int Ed Engl (2015) 54:15720-15724. DOI 10.1002/anie.201507976 · PubMed

Other PDB entries of the same protein (UniProt P31947 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IQU 1.05 Å, Crystal Structure of human 14-3-3 sigma in Complex with Raf1 peptide (6mer)
7AZ2 1.08 Å, 14-3-3 sigma with Pin1 binding site pS72 and covalently bound LvD1014
6HMT 1.1 Å, Ternary complex of Estrogen Receptor alpha peptide and 14-3-3 sigma C42 mutant bound to…
7BAA 1.1 Å, Cys-42-tethered stabilizer 12 of 14-3-3(sigma)/ERa PPI
8BZC 1.1 Å, co-soaked stabilizers for ERa - 14-3-3 interaction (884_AZ244)
8BZW 1.1 Å, Co-soaked stabilizers for ERa - 14-3-3 interaction (844_AZ210)
8C04 1.1 Å, Co-soaked stabilizers for ERa - 14-3-3 interaction (884_AZ354)
9GG8 1.1 Å, Crystal structure of 14-3-3 sigma dC - C38N in complex with Tau pS214 peptide and…
8ANC 1.11 Å, 14-3-3 sigma sirtuin-3 phospho-peptide complex
6Y1J 1.13 Å, 14-3-3 sigma in complex with IkappaBalpha pS63 peptide
6G6X 1.13 Å, 14-3-3sigma in complex with a P129beta3P mutated YAP pS127 phosphopeptide
6NV2 1.13 Å, 14-3-3 sigma with RelA/p65 binding site pS45 in complex with DP005

Browse structure collections

About this viewer

MolViewer shows 4Y5I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.